KEGG   Halovivax ruber: Halru_3086Help
Entry
Halru_3086        CDS       T02402                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hru  Halovivax ruber
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Halru_3086
Enzymes [BR:hru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Halru_3086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3116360..3117145
Genome map
AA seq 261 aa AA seqDB search
MAPDTASAQRSAGDRPRIAAFRPADERLDRAADTLRGLGAEPVTDPMLAVEPTGEAPRSG
ADYVVLTSKTGVELAADAGWEPGAATVCAIGPATADALDEAGYQVDVVPEEYTSNGLVET
LTAESDIDAASVEIARSDHGSQVLIDGLADAGATVHETVLYRLVRPAASGESAELAAAGE
LDAVCFTSSLTVEHFLAAADEREVGAAVHDALDEVVVGVIGAPTAETARDRGIDVDVVAS
EATFETLARETVARLDERTTR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaccggacacggcatcggcccaacgatcggcgggcgaccgcccacgtatcgccgcc
ttcagaccggccgacgagcgactcgaccgcgcggccgacacgctccgcggcctcggcgcc
gaacccgtcaccgacccgatgctggccgtcgagccgaccggtgaggcaccccggtcgggc
gccgactacgtcgtcctgacgagcaagaccggtgtcgaactcgccgctgacgccggctgg
gagcccggcgccgctaccgtctgtgccatcggcccggcgaccgccgacgcgctggacgag
gccggctatcaggtcgacgtcgtccccgaagagtacacctcgaacggactcgtcgagaca
ctcaccgccgaatccgacatcgacgcggcatccgtcgagattgcccggagcgatcacggg
agtcaagtgctcatagacggcctggcggacgcgggtgcgacagtccacgaaaccgtcctg
tatcgactcgtccgacccgcagcaagcggtgagtcagccgaactggccgcagccggcgag
ctcgacgccgtctgcttcacctcgtcgctcaccgtcgaacacttcctcgccgctgccgac
gaacgcgaggtcggcgcggccgtgcacgacgccctggacgaggtcgtcgtcggcgtcatc
ggcgcgccgacggccgagaccgctcgtgaccgcggaatcgacgtcgacgtcgtcgcaagc
gaggccacgttcgagacgctcgcacgcgagacggtggcccgactcgacgagcgaaccacg
cgatag

DBGET integrated database retrieval system