KEGG   Halovivax ruber: Halru_3163Help
Entry
Halru_3163        CDS       T02402                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hru  Halovivax ruber
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halru_3163
   00030 Pentose phosphate pathway
    Halru_3163
   00051 Fructose and mannose metabolism
    Halru_3163
   00052 Galactose metabolism
    Halru_3163
   00500 Starch and sucrose metabolism
    Halru_3163
   00520 Amino sugar and nucleotide sugar metabolism
    Halru_3163
  Nucleotide metabolism
   00230 Purine metabolism
    Halru_3163
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halru_3163
Enzymes [BR:hru01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Halru_3163
    5.4.2.8  phosphomannomutase
     Halru_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3200193..3201557
Genome map
AA seq 454 aa AA seqDB search
MEVFGSSGARGVANEELTPAFVLRVAKAAGTAWGAPRVAIGRDTRHTGRMLVDAATSGLA
SVGADVDRLGIAPTPGVQAYAGREGVPAIVVTASHNPPEYNGVKLIGADGVELSVAELET
IEETLLAEDFADVAWDEIGQVRAIDGTREAYVEDVLAAVDRERIAAADLTVALDPGHGAG
SLTSPDVFRALGCHVVTVNAQPDGHFPGRDPEPVAENLGELGRLVRAADADVGIAHDGDA
DRAIFFDETGTHLEGDATFAALAAAELDADDALVSAVNVSQRLVDVATDVGADVELTPIG
STNIITRIRELDAEGRHVPIAGEGNGGIFFPDYRLARDGAYIAARFLELVAETPASELVA
PYDGYANVRRNVEYASTAECDAMLEAAAAYAEDADASVTSRDGYRLDYGDAWVLARPSGT
EPLVRIYAEARDRDRAEELVTDVHEALLAATGQA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaggtattcgggtcgagtggtgcacgcggcgtagcgaacgaggagttgacaccggcg
ttcgtgctccgcgtcgcgaaggcggccgggacggcgtggggcgctccgcgcgtcgcgatc
ggccgcgatacgcgccacaccggccggatgctcgtcgacgcggcgacgagcgggctagcg
agcgtcggtgccgacgtcgatcggctcgggatcgccccgacgcccggtgtccaggcctac
gcggggcgcgaaggcgtgccggcgatcgtcgtcacggcctcgcacaacccgcccgagtac
aacggcgtgaagctgatcggcgccgacggcgtcgaactctcggtcgccgaactggagacg
atcgaggagacgctgctcgccgaggacttcgccgacgtcgcctgggacgagatcgggcag
gtgcgagcgatcgacggcaccagagaggcgtacgtcgaggacgtcctcgcggcggtcgac
cgcgagcgaatcgccgcggccgacctcaccgtcgcgttagaccccggccacggcgccggg
tcgctgacgagcccggacgtgttccgggcgctgggctgtcacgtcgtcaccgtcaacgcc
cagcccgacgggcacttccccggtcgcgatccggaacccgtcgcggaaaacttaggcgag
ctcggccgactggttcgcgccgccgacgccgacgtcggcatcgcccacgacggcgacgcc
gaccgggcgatcttcttcgacgagaccggcacccacttagaaggcgacgcaaccttcgca
gccctcgccgcggcggaactcgacgcggacgacgcgctcgtctcggccgtgaacgtctcc
cagcgactcgtcgacgtcgccaccgacgtcggagccgacgtggaactcacaccgatcggg
tcaacgaacatcatcacgcgcatccgcgagctcgacgccgagggacgccacgtcccgatc
gccggcgagggcaacggcgggatcttcttcccagactaccggctcgcccgcgacggcgcc
tacatcgcagctcgcttcctcgaactcgtcgccgagacgcccgccagcgagctcgtcgcg
ccgtacgacggctacgccaacgtccgccgaaacgtcgagtacgcgtcaacggccgagtgc
gacgccatgctcgaggccgcagccgcctacgccgaggacgccgacgcgtcggtgacctcc
cgcgacggctaccggctcgactacggcgacgcctgggtgctcgctcgcccctctggaacc
gagccgctcgtgcgaatctacgccgaggcgcgtgaccgggaccgggccgaggaactcgtg
acggacgtccacgaggcactgctggccgctacggggcaggcgtaa

DBGET integrated database retrieval system