KEGG   Homo sapiens (human): 23394Help
Entry
23394             CDS       T01001                                 

Gene name
ADNP, ADNP1, HVDAS, MRD28
Definition
(RefSeq) activity dependent neuroprotector homeobox
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H2P0(Tbio)
UniProt: 
Position
20q13.13
AA seq 1102 aa AA seqDB search
MFQLPVNNLGSLRKARKTVKKILSDIGLEYCKEHIEDFKQFEPNDFYLKNTTWEDVGLWD
PSLTKNQDYRTKPFCCSACPFSSKFFSAYKSHFRNVHSEDFENRILLNCPYCTFNADKKT
LETHIKIFHAPNASAPSSSLSTFKDKNKNDGLKPKQADSVEQAVYYCKKCTYRDPLYEIV
RKHIYREHFQHVAAPYIAKAGEKSLNGAVPLGSNAREESSIHCKRCLFMPKSYEALVQHV
IEDHERIGYQVTAMIGHTNVVVPRSKPLMLIAPKPQDKKSMGLPPRIGSLASGNVRSLPS
QQMVNRLSIPKPNLNSTGVNMMSSVHLQQNNYGVKSVGQGYSVGQSMRLGLGGNAPVSIP
QQSQSVKQLLPSGNGRSYGLGSEQRSQAPARYSLQSANASSLSSGQLKSPSLSQSQASRV
LGQSSSKPAAAATGPPPGNTSSTQKWKICTICNELFPENVYSVHFEKEHKAEKVPAVANY
IMKIHNFTSKCLYCNRYLPTDTLLNHMLIHGLSCPYCRSTFNDVEKMAAHMRMVHIDEEM
GPKTDSTLSFDLTLQQGSHTNIHLLVTTYNLRDAPAESVAYHAQNNPPVPPKPQPKVQEK
ADIPVKSSPQAAVPYKKDVGKTLCPLCFSILKGPISDALAHHLRERHQVIQTVHPVEKKL
TYKCIHCLGVYTSNMTASTITLHLVHCRGVGKTQNGQDKTNAPSRLNQSPSLAPVKRTYE
QMEFPLLKKRKLDDDSDSPSFFEEKPEEPVVLALDPKGHEDDSYEARKSFLTKYFNKQPY
PTRREIEKLAASLWLWKSDIASHFSNKRKKCVRDCEKYKPGVLLGFNMKELNKVKHEMDF
DAEWLFENHDEKDSRVNASKTADKKLNLGKEDDSSSDSFENLEEESNESGSPFDPVFEVE
PKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQD
DVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQ
GDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNM
TDGVAEPMHGSLAGVKLSSQQA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgttccaacttcctgtcaacaatcttggcagtttaagaaaagcccggaaaactgtgaaa
aaaatacttagtgacattgggttggaatactgtaaagaacatatagaagattttaaacaa
tttgaacctaatgacttttatttgaaaaacactacatgggaggatgtaggactgtgggac
ccatcacttacgaaaaaccaggactatcggacaaaacctttctgctgcagcgcttgtcca
ttttcctcaaaattcttctctgcctacaaaagtcatttccgcaatgtccatagtgaagac
tttgaaaataggattctccttaattgcccctactgtaccttcaatgcagacaaaaagact
ttggaaacacacattaaaatatttcatgctccgaacgccagcgcaccaagtagcagcctc
agcactttcaaagataaaaacaaaaatgatggccttaaacctaagcaggctgacagtgta
gagcaagctgtttattactgtaagaagtgcacttaccgagatcctctttatgaaatagtt
aggaagcacatttacagggaacattttcagcatgtggcagcaccttacatagcaaaggca
ggagaaaaatcactcaatggggcagtccccttaggctcgaatgcccgagaagagagtagt
attcactgcaagcgatgccttttcatgccaaagtcctatgaagctttggtacagcatgtc
atcgaagaccatgaacgtataggctatcaggtcactgccatgattgggcacacaaatgta
gtggttccccgatccaaacccttgatgctaattgctcccaaacctcaagacaagaagagc
atgggactcccaccaaggatcggttcccttgcttctggaaatgtccggtctttaccatca
cagcagatggtgaatcgactctcaataccaaagcctaacttaaattctacaggagtcaac
atgatgtccagtgttcatctgcagcagaacaactatggagtcaaatctgtaggccagggt
tacagtgttggtcagtcaatgagactgggtctaggtggcaacgcaccagtttccattcct
caacaatctcagtctgtaaagcagttacttccaagtggaaacggaaggtcttatgggctt
gggtcagagcagaggtcccaggcaccagcaagatactccctgcagtctgctaatgcctct
tctctctcatcgggccagttaaagtctccttccctctctcagtcacaggcatccagagtg
ttaggtcagtccagttccaaacctgctgcagctgccacaggccctcccccaggtaacact
tcctcaactcaaaagtggaaaatatgtacaatctgtaatgagctttttcctgaaaatgtc
tatagtgtgcacttcgaaaaagaacataaagctgagaaagtcccagcagtagccaactac
attatgaaaatacacaattttactagcaaatgcctctactgtaatcgctatttacccaca
gatactctgctcaaccatatgttaattcatggtctgtcttgtccatattgccgttcaact
ttcaatgatgtggaaaagatggccgcacacatgcggatggttcacattgatgaagagatg
ggacctaaaacagattctactttgagttttgatttgacattgcagcagggtagtcacact
aacatccatctcctggtaactacatacaatctgagggatgccccagctgaatctgttgct
taccatgcccaaaataatcctccagttcctccaaagccacagccaaaggttcaggaaaag
gcagatatccctgtaaaaagttcacctcaagctgcagtgccctataaaaaagatgttggg
aaaaccctttgtcctctttgcttttcaatcctaaaaggacccatatctgatgcacttgca
catcacttacgagagaggcaccaagttattcagacggttcatccagttgagaaaaagctc
acctacaaatgtatccattgccttggtgtgtataccagcaacatgaccgcctcaactatc
actctgcatctagttcactgcaggggcgttggaaagacccaaaatggccaggataagaca
aatgcaccctctcggcttaatcagtctccaagtctggcacctgtgaagcgcacttacgag
caaatggaatttcccttactgaaaaaacgaaagttagatgatgatagtgattcacccagc
ttctttgaagagaagcctgaagagcctgttgttttagctttagaccccaagggtcatgaa
gatgattcctatgaagccaggaaaagctttctaacaaagtatttcaacaaacagccctat
cccaccaggagagaaattgagaagctagcagccagtttatggttatggaagagtgacatc
gcttcccattttagtaacaaaaggaagaagtgtgtccgtgattgtgaaaagtacaagcct
ggcgtgttgctggggtttaacatgaaagaattaaataaagtcaagcatgagatggatttt
gatgctgagtggctatttgaaaatcatgatgagaaggattccagagtcaatgctagtaag
actgctgacaaaaagctcaaccttgggaaggaagatgacagttcctcagacagttttgaa
aatttggaagaagaatccaatgaaagtggtagcccttttgaccctgtttttgaagttgaa
cctaaaatctctaacgataacccagaggaacatgtactgaaggtaattcctgaggatgct
tcagaatctgaggagaagctagaccaaaaagaggatggttcaaaatacgaaactattcat
ttgactgaggaaccaaccaaactaatgcacaatgcatctgatagtgaggttgaccaagac
gatgttgttgagtggaaagacggtgcttctccatctgagagtgggcctggatcccaacaa
gtgtcagactttgaggacaatacctgcgaaatgaaaccaggaacctggtctgacgagtct
tcccaaagcgaagatgcaaggagcagtaagccagctgccaaaaaaaaggctaccatgcaa
ggtgacagagagcagttgaaatggaagaatagttcctatggaaaagttgaagggttttgg
tctaaggaccagtcacagtggaagaatgcatctgagaatgatgagcgcttatctaacccc
cagattgagtggcagaatagcacaattgacagtgaggatggggaacagtttgacaacatg
actgatggagtagctgagcccatgcatggcagcttagccggagttaaactgagcagccaa
caggcctaa

DBGET integrated database retrieval system