KEGG   Homo sapiens (human): 5443Help
Entry
5443              CDS       T01001                                 

Gene name
POMC, ACTH, CLIP, LPH, MSH, NPP, POC
Definition
(RefSeq) proopiomelanocortin
  KO
K05228  proopiomelanocortin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04916  Melanogenesis
hsa04920  Adipocytokine signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing's syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    5443 (POMC)
   04916 Melanogenesis
    5443 (POMC)
   04925 Aldosterone synthesis and secretion
    5443 (POMC)
   04927 Cortisol synthesis and secretion
    5443 (POMC)
 Human Diseases
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    5443 (POMC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACTH_domain NPP Op_neuropeptide ACTH_assoc
Motif
Other DBs
NCBI-GeneID: 5443
NCBI-ProteinID: NP_000930
OMIM: 176830
HGNC: 9201
Ensembl: ENSG00000115138
Vega: OTTHUMG00000094764
Pharos: P01189(Tbio)
UniProt: P01189
Position
2p23.3
AA seq 267 aa AA seqDB search
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG
PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL
TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF
MTSEKSQTPLVTLFKNAIIKNAYKKGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccgagatcgtgctgcagccgctcgggggccctgttgctggccttgctgcttcaggcc
tccatggaagtgcgtggctggtgcctggagagcagccagtgtcaggacctcaccacggaa
agcaacctgctggagtgcatccgggcctgcaagcccgacctctcggccgagactcccatg
ttcccgggaaatggcgacgagcagcctctgaccgagaacccccggaagtacgtcatgggc
cacttccgctgggaccgattcggccgccgcaacagcagcagcagcggcagcagcggcgca
gggcagaagcgcgaggacgtctcagcgggcgaagactgcggcccgctgcctgagggcggc
cccgagccccgcagcgatggtgccaagccgggcccgcgcgagggcaagcgctcctactcc
atggagcacttccgctggggcaagccggtgggcaagaagcggcgcccagtgaaggtgtac
cctaacggcgccgaggacgagtcggccgaggccttccccctggagttcaagagggagctg
actggccagcgactccgggagggagatggccccgacggccctgccgatgacggcgcaggg
gcccaggccgacctggagcacagcctgctggtggcggccgagaagaaggacgagggcccc
tacaggatggagcacttccgctggggcagcccgcccaaggacaagcgctacggcggtttc
atgacctccgagaagagccagacgcccctggtgacgctgttcaaaaacgccatcatcaag
aacgcctacaagaagggcgagtga

DBGET integrated database retrieval system