KEGG   Homo sapiens (human): 9048Help
Entry
9048              CDS       T01001                                 

Gene name
ARTN, ART, ENOVIN, EVN, NBN
Definition
(RefSeq) artemin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q5T4W7(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 220 aa AA seqDB search
MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLAS
PAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGA
RGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGS
RPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaacttggacttggaggcctctccacgctgtcccactgcccctggcctaggcagcag
cctgccctgtggcccaccctggccgctctggctctgctgagcagcgtcgcagaggcctcc
ctgggctccgcgccccgcagccctgccccccgcgaaggccccccgcctgtcctggcgtcc
cccgccggccacctgccggggggacgcacggcccgctggtgcagtggaagagcccggcgg
ccgccgccgcagccttctcggcccgcgcccccgccgcctgcacccccatctgctcttccc
cgcgggggccgcgcggcgcgggctgggggcccgggcagccgcgctcgggcagcgggggcg
cggggctgccgcctgcgctcgcagctggtgccggtgcgcgcgctcggcctgggccaccgc
tccgacgagctggtgcgtttccgcttctgcagcggctcctgccgccgcgcgcgctctcca
cacgacctcagcctggccagcctactgggcgccggggccctgcgaccgcccccgggctcc
cggcccgtcagccagccctgctgccgacccacgcgctacgaagcggtctccttcatggac
gtcaacagcacctggagaaccgtggaccgcctctccgccaccgcctgcggctgcctgggc
tga

DBGET integrated database retrieval system