KEGG   Homo sapiens (human): 100Help
Entry
100               CDS       T01001                                 

Gene name
ADA
Definition
adenosine deaminase (EC:3.5.4.4)
Orthology
K01488  
adenosine deaminase [EC:3.5.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Metabolic pathways
Primary immunodeficiency
Disease
H00092  
T-B-Severe combined immunodeficiencies (SCIDs)
Drug target
Pentostatin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100 (ADA)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    100 (ADA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     100 (ADA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.12
AA seq 363 aa AA seqDB search
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPD
FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAI
DLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY
HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF
KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAG
QNL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacgcccgccttcgacaagcccaaagtagaactgcatgtccacctagacgga
tccatcaagcctgaaaccatcttatactatggcaggaggagagggatcgccctcccagct
aacacagcagaggggctgctgaacgtcattggcatggacaagccgctcacccttccagac
ttcctggccaagtttgactactacatgcctgctatcgcgggctgccgggaggctatcaaa
aggatcgcctatgagtttgtagagatgaaggccaaagagggcgtggtgtatgtggaggtg
cggtacagtccgcacctgctggccaactccaaagtggagccaatcccctggaaccaggct
gaaggggacctcaccccagacgaggtggtggccctagtgggccagggcctgcaggagggg
gagcgagacttcggggtcaaggcccggtccatcctgtgctgcatgcgccaccagcccaac
tggtcccccaaggtggtggagctgtgtaagaagtaccagcagcagaccgtggtagccatt
gacctggctggagatgagaccatcccaggaagcagcctcttgcctggacatgtccaggcc
taccaggaggctgtgaagagcggcattcaccgtactgtccacgccggggaggtgggctcg
gccgaagtagtaaaagaggctgtggacatactcaagacagagcggctgggacacggctac
cacaccctggaagaccaggccctttataacaggctgcggcaggaaaacatgcacttcgag
atctgcccctggtccagctacctcactggtgcctggaagccggacacggagcatgcagtc
attcggctcaaaaatgaccaggctaactactcgctcaacacagatgacccgctcatcttc
aagtccaccctggacactgattaccagatgaccaaacgggacatgggctttactgaagag
gagtttaaaaggctgaacatcaatgcggccaaatctagtttcctcccagaagatgaaaag
agggagcttctcgacctgctctataaagcctatgggatgccaccttcagcctctgcaggg
cagaacctctga

DBGET integrated database retrieval system