KEGG   Homo sapiens (human): 10055Help
Entry
10055             CDS       T01001                                 

Gene name
SAE1, AOS1, HSPC140, SUA1, UBLE1A
Definition
SUMO1 activating enzyme subunit 1
Orthology
K10684  
ubiquitin-like 1-activating enzyme E1 A [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10055 (SAE1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     10055 (SAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 299 aa AA seqDB search
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGV
KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE
SFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDY
FLLQGPVSAGPSSQQLLLLRWHEGEWDCGVPWPQVNSRFGSPRDANCSMPTCIPCPLPS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaaggaggaggctggcggcggcattagcgaggaggaggcggcacagtatgac
cggcagatccgcctgtggggactggaggcccagaaacggctgcgggcctctcgggtgctt
cttgtcggcttgaaaggacttggggctgaaattgccaagaatctcatcttggcaggagtg
aaaggactgaccatgctggatcacgaacaggtaactccagaagatcccggagctcagttc
ttgattcgtactgggtctgttggccgaaatagggctgaagcctctttggagcgagctcag
aatctcaaccccatggtggatgtgaaggtggacactgaggatatagagaagaaaccagag
tcatttttcactcaattcgatgctgtgtgtctgacttgctgctccagggatgtcatagtt
aaagttgaccagatctgtcacaaaaatagcatcaagttctttacaggagatgtttttggc
taccatggatacacatttgccaatctaggagagcatgagtttgtagaggagaaaactaaa
gttgccaaagttagccaaggagtagaagatgggcccgacaccaagagagcaaaacttgat
tcttctgagacaacgatggtcaaaaagaaggtggtcttctgccctgttaaagaagccctg
gaggtggactggagcagtgagaaagcaaaggctgctctgaagcgcacgacctccgactac
tttctccttcaaggccctgtctcagcgggaccctcctcacaacaacttcttcttcttcga
tggcatgaaggggaatgggattgtggagtgccttggccccaagtgaactcaagatttggc
agccccagagatgccaactgcagcatgcccacctgtattccctgtccccttccttcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system