KEGG   Homo sapiens (human): 10055Help
Entry
10055             CDS       T01001                                 

Gene name
SAE1, AOS1, HSPC140, SUA1, UBLE1A
Definition
SUMO1 activating enzyme subunit 1
Orthology
K10684  
ubiquitin-like 1-activating enzyme E1 A [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 299 aa AA seqDB search
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGV
KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE
SFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDY
FLLQGPVSAGPSSQQLLLLRWHEGEWDCGVPWPQVNSRFGSPRDANCSMPTCIPCPLPS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaaggaggaggctggcggcggcattagcgaggaggaggcggcacagtatgac
cggcagatccgcctgtggggactggaggcccagaaacggctgcgggcctctcgggtgctt
cttgtcggcttgaaaggacttggggctgaaattgccaagaatctcatcttggcaggagtg
aaaggactgaccatgctggatcacgaacaggtaactccagaagatcccggagctcagttc
ttgattcgtactgggtctgttggccgaaatagggctgaagcctctttggagcgagctcag
aatctcaaccccatggtggatgtgaaggtggacactgaggatatagagaagaaaccagag
tcatttttcactcaattcgatgctgtgtgtctgacttgctgctccagggatgtcatagtt
aaagttgaccagatctgtcacaaaaatagcatcaagttctttacaggagatgtttttggc
taccatggatacacatttgccaatctaggagagcatgagtttgtagaggagaaaactaaa
gttgccaaagttagccaaggagtagaagatgggcccgacaccaagagagcaaaacttgat
tcttctgagacaacgatggtcaaaaagaaggtggtcttctgccctgttaaagaagccctg
gaggtggactggagcagtgagaaagcaaaggctgctctgaagcgcacgacctccgactac
tttctccttcaaggccctgtctcagcgggaccctcctcacaacaacttcttcttcttcga
tggcatgaaggggaatgggattgtggagtgccttggccccaagtgaactcaagatttggc
agccccagagatgccaactgcagcatgcccacctgtattccctgtccccttccttcatga

DBGET integrated database retrieval system