KEGG   Homo sapiens (human): 10157Help
Entry
10157             CDS       T01001                                 

Gene name
AASS, LKR/SDH, LKRSDH, LORSDH
Definition
aminoadipate-semialdehyde synthase (EC:1.5.1.8 1.5.1.9)
Orthology
K14157  
alpha-aminoadipic semialdehyde synthase [EC:1.5.1.8 1.5.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Metabolic pathways
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Disease
H00188  
Hyperlysinemia
H01242  
Saccharopinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    10157 (AASS)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.8  saccharopine dehydrogenase (NADP+, L-lysine-forming)
     10157 (AASS)
    1.5.1.9  saccharopine dehydrogenase (NAD+, L-glutamate-forming)
     10157 (AASS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
7q31.3
AA seq 926 aa AA seqDB search
MLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQ
PSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANM
GLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFM
HIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPC
EYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIA
PYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFSPAGVEGCPALPHKLVAICDISADTG
GSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLY
PYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGTR
RKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYNINPVSMDICKQEEKL
GFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGE
LGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYKFSWSPVGVLMN
VMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGYPNRDSTKYAEIYGISSAHTL
LRGTLRYKGYMKALNGFVKLGLINREALPAFRPEANPLTWKQLLCDLVGISPSSEHDVLK
EAVLKKLGGDNTQLEAAEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRD
SFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFS
KEIYGPILERIKAEGIIYTTQSTIKP
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagtacataggactggactgggcaggctgggggtcagcctctccaagggtctt
caccacaaagctgtgttggccgtccggagggaggatgtgaacgcctgggagagaagggcc
ccgctagctcccaagcacatcaaaggcatcaccaatctgggatacaaggtcttgatacag
ccttcgaatcggcgggccattcatgataaggactatgtcaaagctggtggcattcttcag
gaggatatttctgaagcttgtctaattttaggagttaaaagacctccagaggaaaaatta
atgtccaggaagacttatgcatttttctcccacacaataaaagctcaggaggccaatatg
ggcttgttggatgagattctaaaacaggaaattcgccttattgattatgagaaaatggtg
gatcatagaggagtacgggtagtggcatttggacagtgggctggtgtggcaggaatgatc
aacattttacatggaatgggtttaaggctccttgctttgggacatcacacaccttttatg
cacattggcatggctcataactacaggaatagcagtcaggctgtgcaagctgtccgtgat
gctggctatgaaatatctttgggtttgatgcctaagtcaataggacccttaacatttgtg
ttcacaggaactggtaatgtttctaagggagcccaagcaatctttaatgagctaccttgt
gaatatgtggagccccatgaattaaaagaagtttcccaaactggagacctcagaaaagtg
tatgggacggtgttaagtcgtcatcatcatcttgtcaggaaaacagatgctgtgtatgat
cctgcagagtatgacaaacatccggagcgctacataagtcgttttaatactgatattgca
ccctatacaacttgcttaattaatggaatctactgggaacaaaacactcctcgcctccta
acccgccaagatgctcagagtctcctggctccgggcaagttctcacctgctggtgtggaa
ggctgccctgcattaccacacaaactcgtggcaatatgtgacatttcagctgacacagga
gggtctatagagtttatgactgagtgtacaacaatagagcatcccttttgcatgtatgat
gcagaccagcatattattcatgacagtgttgaaggctcggggatcctgatgtgttccatt
gacaatttgccggcacagctcccaattgaagctacagaatgctttggagacatgctttac
ccttatgttgaagaaatgatattatcagacgcgacacagcctcttgaaagtcagaatttt
tctcctgtggtgagagatgcagtgattacatccaacggtacattacctgataaatataaa
tatatccagacactccgggagagcagggaacgtgctcagtcactttcaatgggcaccagg
agaaaggttttggttcttggatctggctacatatctgagcctgtattagaatatttatca
agagatggcaatatagaaataacagtaggatctgacatgaagaatcaaattgaacagtta
ggcaagaaatataatattaatcctgttagcatggacatttgtaaacaagaagagaagctg
ggcttcttggtggcaaaacaggatcttgtcatcagcttgttgccttatgtattgcaccct
cttgtggccaaggcctgcatcacaaacaaagttaacatggtcactgcaagctacatcaca
ccagcactaaaagaattggaaaagagtgtggaagatgctggcatcacaatcattggtgaa
ttgggattggaccctggtctggatcacatgttagcaatggaaacaatagataaagccaag
gaagtgggagccacgattgaatcatatatttcctactgtggtgggcttccagcccctgaa
cattcaaacaatccattgagatataaatttagctggagtccagtgggagttttgatgaat
gtaatgcagtctgccacctatctgctcgatggaaaggttgtgaatgttgcaggaggcatc
tcctttcttgatgccgttacgtccatggatttttttccaggattaaatttggaaggctat
cctaacagagacagtacgaaatatgctgagatttatggcatttcttctgctcacactttg
ttgcgggggacactgagatataagggatatatgaaagctttgaatggatttgtaaaatta
ggtcttataaacagagaagcgcttcctgcctttagacctgaggccaaccctctcacctgg
aaacaactcctctgtgacctagttgggatttcaccctcctctgagcatgatgtgttgaag
gaagctgttcttaagaaactaggaggagacaatacccagttggaggctgctgaatggttg
ggcttacttggggatgaacaagttcctcaggcagagtccattctggatgccctctccaag
catttggtcatgaagctttcctatggtcctgaagaaaaagatatgattgtgatgagagac
agctttggaatcagacatccttctggacatttagaacataaaacgattgatcttgtggct
tatggggacatcaatggcttttcagccatggctaaaaccgtggggttacccaccgccatg
gcagccaaaatgttgcttgatggtgaaattggagccaaaggcctaatggggcccttttca
aaggagatctatggaccaatattggagcgaattaaagcagaaggcattatatatactaca
cagagtacaattaaaccataa

DBGET integrated database retrieval system