KEGG   Homo sapiens (human): 10157Help
Entry
10157             CDS       T01001                                 

Gene name
AASS, LKR/SDH, LKRSDH, LORSDH
Definition
aminoadipate-semialdehyde synthase (EC:1.5.1.8 1.5.1.9)
Orthology
K14157  
alpha-aminoadipic semialdehyde synthase [EC:1.5.1.8 1.5.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Metabolic pathways
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Disease
H00188  
Hyperlysinemia
H01242  
Saccharopinuria
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
7q31.3
AA seq 926 aa AA seqDB search
MLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQ
PSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANM
GLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFM
HIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPC
EYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIA
PYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFSPAGVEGCPALPHKLVAICDISADTG
GSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLY
PYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGTR
RKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYNINPVSMDICKQEEKL
GFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGE
LGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYKFSWSPVGVLMN
VMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGYPNRDSTKYAEIYGISSAHTL
LRGTLRYKGYMKALNGFVKLGLINREALPAFRPEANPLTWKQLLCDLVGISPSSEHDVLK
EAVLKKLGGDNTQLEAAEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRD
SFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFS
KEIYGPILERIKAEGIIYTTQSTIKP
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagtacataggactggactgggcaggctgggggtcagcctctccaagggtctt
caccacaaagctgtgttggccgtccggagggaggatgtgaacgcctgggagagaagggcc
ccgctagctcccaagcacatcaaaggcatcaccaatctgggatacaaggtcttgatacag
ccttcgaatcggcgggccattcatgataaggactatgtcaaagctggtggcattcttcag
gaggatatttctgaagcttgtctaattttaggagttaaaagacctccagaggaaaaatta
atgtccaggaagacttatgcatttttctcccacacaataaaagctcaggaggccaatatg
ggcttgttggatgagattctaaaacaggaaattcgccttattgattatgagaaaatggtg
gatcatagaggagtacgggtagtggcatttggacagtgggctggtgtggcaggaatgatc
aacattttacatggaatgggtttaaggctccttgctttgggacatcacacaccttttatg
cacattggcatggctcataactacaggaatagcagtcaggctgtgcaagctgtccgtgat
gctggctatgaaatatctttgggtttgatgcctaagtcaataggacccttaacatttgtg
ttcacaggaactggtaatgtttctaagggagcccaagcaatctttaatgagctaccttgt
gaatatgtggagccccatgaattaaaagaagtttcccaaactggagacctcagaaaagtg
tatgggacggtgttaagtcgtcatcatcatcttgtcaggaaaacagatgctgtgtatgat
cctgcagagtatgacaaacatccggagcgctacataagtcgttttaatactgatattgca
ccctatacaacttgcttaattaatggaatctactgggaacaaaacactcctcgcctccta
acccgccaagatgctcagagtctcctggctccgggcaagttctcacctgctggtgtggaa
ggctgccctgcattaccacacaaactcgtggcaatatgtgacatttcagctgacacagga
gggtctatagagtttatgactgagtgtacaacaatagagcatcccttttgcatgtatgat
gcagaccagcatattattcatgacagtgttgaaggctcggggatcctgatgtgttccatt
gacaatttgccggcacagctcccaattgaagctacagaatgctttggagacatgctttac
ccttatgttgaagaaatgatattatcagacgcgacacagcctcttgaaagtcagaatttt
tctcctgtggtgagagatgcagtgattacatccaacggtacattacctgataaatataaa
tatatccagacactccgggagagcagggaacgtgctcagtcactttcaatgggcaccagg
agaaaggttttggttcttggatctggctacatatctgagcctgtattagaatatttatca
agagatggcaatatagaaataacagtaggatctgacatgaagaatcaaattgaacagtta
ggcaagaaatataatattaatcctgttagcatggacatttgtaaacaagaagagaagctg
ggcttcttggtggcaaaacaggatcttgtcatcagcttgttgccttatgtattgcaccct
cttgtggccaaggcctgcatcacaaacaaagttaacatggtcactgcaagctacatcaca
ccagcactaaaagaattggaaaagagtgtggaagatgctggcatcacaatcattggtgaa
ttgggattggaccctggtctggatcacatgttagcaatggaaacaatagataaagccaag
gaagtgggagccacgattgaatcatatatttcctactgtggtgggcttccagcccctgaa
cattcaaacaatccattgagatataaatttagctggagtccagtgggagttttgatgaat
gtaatgcagtctgccacctatctgctcgatggaaaggttgtgaatgttgcaggaggcatc
tcctttcttgatgccgttacgtccatggatttttttccaggattaaatttggaaggctat
cctaacagagacagtacgaaatatgctgagatttatggcatttcttctgctcacactttg
ttgcgggggacactgagatataagggatatatgaaagctttgaatggatttgtaaaatta
ggtcttataaacagagaagcgcttcctgcctttagacctgaggccaaccctctcacctgg
aaacaactcctctgtgacctagttgggatttcaccctcctctgagcatgatgtgttgaag
gaagctgttcttaagaaactaggaggagacaatacccagttggaggctgctgaatggttg
ggcttacttggggatgaacaagttcctcaggcagagtccattctggatgccctctccaag
catttggtcatgaagctttcctatggtcctgaagaaaaagatatgattgtgatgagagac
agctttggaatcagacatccttctggacatttagaacataaaacgattgatcttgtggct
tatggggacatcaatggcttttcagccatggctaaaaccgtggggttacccaccgccatg
gcagccaaaatgttgcttgatggtgaaattggagccaaaggcctaatggggcccttttca
aaggagatctatggaccaatattggagcgaattaaagcagaaggcattatatatactaca
cagagtacaattaaaccataa

DBGET integrated database retrieval system