KEGG   Homo sapiens (human): 10270Help
Entry
10270             CDS       T01001                                 

Gene name
AKAP8, AKAP_95, AKAP-8, AKAP-95, AKAP95
Definition
(RefSeq) A-kinase anchoring protein 8
  KO
K16525  
A-kinase anchor protein 8
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 692 aa AA seqDB search
MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEA
AKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQ
DRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARER
GSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSP
SRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDG
TGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEK
EDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAH
CLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYL
KGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESS
GEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEA
ESAQTRVAPAPAAADAEVEQTDAESKDAVPTE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaccagggctacggaggctacggggcgtggagtgctggacctgccaacacccagggt
gcatatggaactggtgtggccagctggcaaggttatgaaaactacaattactatggcgcc
cagaacaccagtgtcaccacaggcgcaacctacagctacggcccagcctcgtgggaggcc
gccaaggccaatgatggcggcctggcggccggggcccctgccatgcacatggcctcttac
ggcccagagccatgcaccgacaattccgactccctcattgccaagatcaaccagcgtttg
gacatgatgtccaaggaaggaggcaggggcgggagcggcggcggtggggagggcatacag
gaccgggagagctccttccgcttccagccgttcgagtcctatgactccaggccctgcctg
ccggagcacaacccctaccgccccagctacagctacgactatgagttcgacctggggtcc
gaccgcaatggcagctttggggggcagtacagtgaatgccgagacccagcccgggagcgg
ggctcccttgatggcttcatgcggggccggggccagggccgcttccaggaccggagcaac
cctggcaccttcatgcgcagcgaccccttcgtgccccccgctgcgtcctctgagcccctg
tccacgccctggaacgagctgaactacgtgggtggacggggcctgggagggccctccccc
agccggccacctccgtccctcttctcccagtccatggctcccgactacggcgtgatgggc
atgcagggggcgggcggctatgacagcaccatgccctacggatgtggccgctcgcagcct
cggatgcgggatcgggatcggcccaagaggagagggtttgaccgcttcggaccagatggc
acgggcaggaaacggaagcagttccaactttacgaggagccagacaccaaactggcccgg
gttgacagtgaaggagatttctccgaaaatgatgacgcagctggtgacttccgctcagga
gatgaagaattcaagggtgaggatgaactctgcgactctgggaggcaaagaggagagaag
gaggacgaggacgaggatgtgaagaagagaagggaaaagcaaaggagaagagacaggacg
cgggaccgtgcagccgacagaattcagtttgcctgttctgtatgcaagttccgtagcttt
gatgacgaagagatccagaagcatctgcaaagcaaatttcacaaagagaccctgcggttc
ataagcaccaagctgcccgacaagaccgtggagttcctccaggaatacattgtaaacaga
aataagaaaattgagaagcggcgtcaggaattgatggagaaagaaaccgcaaaaccaaaa
ccagatcctttcaaagggattggccaggagcacttcttcaagaagatcgaggctgctcac
tgcctggcctgcgacatgctaattcctgcacagccgcagctcctccagcggcacctgcac
tccgtggaccacaatcacaaccgcaggttggctgctgaacagttcaagaaaaccagtctc
catgtggctaagagtgttttgaacaacagacatatagtgaagatgctggaaaaatacctc
aagggtgaggaccctttcaccagtgaaactgttgatccagaaatggaaggagatgacaat
ttaggaggtgaggataagaaagagacacctgaggaggtggccgcggacgtcttagcagag
gtgattacagcagcagtgagggccgtagatggggaaggagcgcccgctccagagagcagc
ggggagccggctgaggacgaaggccccacggacacagcggaggccggtagtgatcctcaa
gccgaacagctgctggaagagcaggtgccctgtggaacggcacatgagaagggcgtcccc
aaggccagaagtgaggctgcagaggctggaaatggcgccgagacaatggcagcagaggca
gaaagtgcccaaaccagagttgctcctgccccagctgccgcggatgctgaagtggaacaa
actgatgcagagtctaaagacgctgttcccacagaatga

DBGET integrated database retrieval system