KEGG   Homo sapiens (human): 10397Help
Entry
10397             CDS       T01001                                 

Gene name
NDRG1, CAP43, CMT4D, DRG-1, DRG1, GC4, HMSNL, NDR1, NMSL, PROXY1, RIT42, RTP, TARG1, TDD5
Definition
N-myc downstream regulated 1
Orthology
K18266  
protein NDRG1
Organism
hsa  Homo sapiens (human)
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10397 (NDRG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 394 aa AA seqDB search
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVIL
TYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAE
MLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKI
SGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIE
RPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGT
RSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgggagatgcaggatgtagacctcgctgaggtgaagcctttggtggagaaaggg
gagaccatcaccggcctcctgcaagagtttgatgtccaggagcaggacatcgagacttta
catggctctgttcacgtcacgctgtgtgggactcccaagggaaaccggcctgtcatcctc
acctaccatgacatcggcatgaaccacaaaacctgctacaaccccctcttcaactacgag
gacatgcaggagatcacccagcactttgccgtctgccacgtggacgcccctggccagcag
gacggcgcagcctccttccccgcagggtacatgtacccctccatggatcagctggctgaa
atgcttcctggagtccttcaacagtttgggctgaaaagcattattggcatgggaacagga
gcaggcgcctacatcctaactcgatttgctctaaacaaccctgagatggtggagggcctt
gtccttatcaacgtgaacccttgtgcggaaggctggatggactgggccgcctccaagatc
tcaggatggacccaagctctgccggacatggtggtgtcccacctttttgggaaggaagaa
atgcagagtaacgtggaagtggtccacacctaccgccagcacattgtgaatgacatgaac
cccggcaacctgcacctgttcatcaatgcctacaacagccggcgcgacctggagattgag
cgaccaatgccgggaacccacacagtcaccctgcagtgccctgctctgttggtggttggg
gacagctcgcctgcagtggatgccgtggtggagtgcaactcaaaattggacccaacaaag
accactctcctcaagatggcggactgtggcggcctcccgcagatctcccagccggccaag
ctcgctgaggccttcaagtacttcgtgcagggcatgggatacatgccctcggctagcatg
acccgcctgatgcggtcccgcacagcctctggttccagcgtcacttctctggatggcacc
cgcagccgctcccacaccagcgagggcacccgaagccgctcccacaccagcgagggcacc
cgcagccgctcgcacaccagcgagggggcccacctggacatcacccccaactcgggtgct
gctgggaacagcgccgggcccaagtccatggaggtctcctgctag

DBGET integrated database retrieval system