KEGG   Homo sapiens (human): 10432Help
Entry
10432             CDS       T01001                                 

Gene name
RBM14, COAA, PSP2, SIP, SYTIP1, TMEM137
Definition
(RefSeq) RNA binding motif protein 14
  KO
K13189  
RNA-binding protein 14
Organism
hsa  Homo sapiens (human)
Brite
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    10432 (RBM14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.2
AA seq 669 aa AA seqDB search
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL
RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME
KEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGG
FSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQ
PSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAAS
SLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRA
AASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASM
GLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASY
RGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSK
RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQ
MHSGYQRRM
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattcgtgggcaacgtcgacggggcggatacgactccggaggagctggcagcc
ctctttgcgccctacggcacggtcatgagctgcgccgtcatgaaacagttcgccttcgtg
cacatgcgcgagaacgcgggcgcgctgcgcgccatcgaagccctgcacggccacgagctg
cggccggggcgcgcgctcgtggtggagatgtcgcgcccaaggcctcttaatacttggaag
attttcgtgggcaatgtgtcggctgcatgcacgagccaggaactgcgcagcctcttcgag
cgccgcggacgcgtcatcgagtgtgacgtggtgaaagactacgcgtttgttcacatggag
aaggaagcagatgccaaagccgcaatcgcgcagctcaacggcaaagaagtgaagggcaag
cgcatcaacgtggaactctccaccaagggtcagaagaaggggcctggcctggctgtccag
tctggggacaagaccaagaaaccaggggctggggatacggccttccctggaactggtggc
ttctctgccaccttcgactaccagcaggcttttggcaacagcactggtggctttgatggg
caagcccgtcagcccacaccacccttctttggtcgcgaccgcagccctctgcgccgttca
cctccccgagcctcttatgtggctcctctgacggcccagccagctacctaccgggcccag
ccgtccgtgtcactgggagctgcctacagggcccagccttctgcctctttgggtgttggc
tatcggactcagcccatgacagcccaggcagcctcttaccgcgctcagccctctgtctcc
cttggggcaccatacaggggccagctggctagtcctagctcccagtctgctgcagcttct
tcactcggcccatatggtggagcccagccctcagcctcggccctttcctcctatgggggt
caggcagctgcagcttcttcgctcaactcctatggggctcagggttcctcccttgcctcc
tatggtaaccagccatcctcttacggcgcccaggctgcctcttcctatggggttcgtgca
gctgcttcttcctacaacacccagggagcagcttcctccttaggctcctacggggctcag
gcagcctcctatggggcccagtctgcagcctcctcactagcttatggagcccaggcagct
tcatataatgcccagccctcggcctcttacaatgcccagtctgccccatatgctgcacag
caggctgcttcctactcttcccaacctgctgcctatgtggcacagccagccacagctgct
gcctatgccagccagccagcagcctacgccgcacaagccactaccccaatggctggctcc
tatggggcccagccggttgtgcagacccagctgaatagttacggggcccaagcatcaatg
ggcctttcaggctcctatggggctcagtcggctgctgcggccactggctcctatggtgcc
gcagcagcctacggggcccaaccttctgccaccctggcagctccttaccgcactcagtca
tcagcctcattggctgcttcctatgctgcccagcagcatccccaggctgctgcctcctac
cgcggccagccaggcaatgcctacgatggggcaggtcagccgtctgcagcctacctgtcc
atgtcccagggggccgttgccaacgccaacagcaccccgccgccctatgagcgtacccgc
ctctccccaccccgggccagctacgacgatccctacaaaaaggctgtcgccatgtcgaaa
aggtatggttccgaccggcgtttagccgagctctctgattaccgccgtttatcagagtcg
cagctttcgttccgccgctcgccgacaaagtcctcgctggattaccgtcgcctgcccgat
gcccattccgattacgcacgctattcgggctcctataatgattacctgcgggcggctcag
atgcactctggctaccagcgccgcatgtag

DBGET integrated database retrieval system