KEGG   Homo sapiens (human): 10483Help
Entry
10483             CDS       T01001                                 

Gene name
SEC23B, CDA-II, CDAII, CDAN2, CWS7, HEMPAS
Definition
(RefSeq) Sec23 homolog B, COPII coat complex component
  KO
K14006  
protein transport protein SEC23
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
COPII complex
Disease
H00917  
Congenital dyserythropoietic anemias (CDAs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10483 (SEC23B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11.23
AA seq 767 aa AA seqDB search
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYV
IQRGAQSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIYACALDQTGLL
EMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAG
AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNTPIPQGGRGA
IQFVTHYQHSSTQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatacctggagttcatccagcagaatgaagaacgggatggtgtgcgttttagt
tggaacgtgtggccttccagccggctggaggctacaagaatggttgtacccctggcttgt
ctccttactcctttgaaagaacgtccagacctacctcctgtacaatatgaacctgtgctt
tgcagcaggccaacttgtaaagctgttctcaacccactttgtcaggttgattatcgagca
aaactttgggcctgtaatttctgttttcaaagaaatcagtttcctccagcttatggaggc
atatctgaggtgaatcaacctgccgaattgatgccccagttttctacaattgagtacgtg
atacagcgaggtgctcagtcccctctgatctttctctatgtggttgacacatgcctggag
gaagatgaccttcaagcactcaaagagtccctgcagatgtccctgagtcttcttcctcca
gatgctctggtgggtctgatcacatttggaaggatggtgcaggttcatgagctaagctgt
gaaggaatctccaaaagttatgtcttccgagggaccaaggatttaactgcaaagcaaata
caggatatgttgggcctgaccaagccagccatgcccatgcagcaagcacgacctgcacaa
ccacaggagcacccttttgcttcaagcagatttctgcagcctgttcacaagattgatatg
aacctcactgatcttcttggggagctacagagggacccatggccagtaactcaggggaag
agacctttgcgatccactggtgtggctttgtccattgctgttggcttgctggagggcact
tttccaaacacaggagccaggatcatgctgtttactggaggtccccctacccaagggcct
ggcatggtggttggagatgaattaaagattcctattcgttcttggcatgatattgagaaa
gataatgcacgattcatgaaaaaggcaaccaagcactatgagatgcttgctaatcgaaca
gctgcaaatggtcactgcattgatatttatgcttgtgcccttgatcaaactggacttttg
gagatgaagtgttgtgcaaatcttactggaggctacatggtaatgggagattctttcaac
acttctctcttcaagcagacattccaaagaatctttactaaagattttaatggagatttc
cgaatggcatttggtgctactttggacgtaaagacctctcgggaactgaagattgcagga
gccattggtccatgcgtatctctgaatgtgaaaggaccgtgtgtgtcagaaaatgagctt
ggtgttggtggcacgagtcagtggaaaatctgtggcctagatcctacatctacacttggc
atctattttgaagttgtcaatcagcacaacaccccgatcccccaaggaggcagaggagcc
atccagtttgtcacgcattatcagcactccagcacccagagacgcatccgcgtgaccacc
atcgcccgaaattgggcagatgtacagagtcagctcaggcacatagaagcagcatttgac
caggaggctgcggcagtgttgatggcacggcttggggtgttccgagcggagtcagaggag
gggcccgatgtgctccggtggctggaccgacaactcatccgactgtgtcaaaagtttgga
cagtataacaaagaagaccccacttcttttaggttatcagattccttttctctatatcct
cagtttatgttccatctgagaagatctccatttcttcaagtgtttaacaacagtcctgat
gagtcgtcatattacagacatcattttgcccggcaggacctgacccagtccctcatcatg
atccagcccattctctactcttactcctttcatgggccaccagagccagtactcttggat
agcagcagcattctagctgacagaattttgctgatggatactttctttcaaattgtcatt
tatcttggtgagaccatagcccagtggcgtaaagctggctaccaggacatgcccgagtat
gaaaacttcaagcaccttctgcaggcaccactggatgatgctcaagaaattctgcaagca
cgcttcccgatgccacgttacatcaacacggagcatggaggcagtcaggctcgattcctt
ttgtccaaagtgaacccatctcagacacacaataacctgtatgcttggggacaggaaact
ggagcacccatcctaactgatgatgttagcctgcaggtgttcatggaccatttgaagaag
ctggctgtctccagtgcctgttaa

DBGET integrated database retrieval system