KEGG   Homo sapiens (human): 1050Help
Entry
1050              CDS       T01001                                 

Gene name
CEBPA, C/EBP-alpha, CEBP
Definition
CCAAT/enhancer binding protein (C/EBP), alpha
Orthology
K09055  
CCAAT/enhancer binding protein (C/EBP), alpha
Organism
hsa  Homo sapiens (human)
Pathway
Non-alcoholic fatty liver disease (NAFLD)
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 239 aa AA seqDB search
MPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLF
PYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAP
ALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKS
RDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggggagcgcacgggcccccgcccggctacggctgcgcggccgccggctacctg
gacggcaggctggagcccctgtacgagcgcgtcggggcgccggcgctgcggccgctggtg
atcaagcaggagccccgcgaggaggatgaagccaagcagctggcgctggccggcctcttc
ccttaccagccgccgccgccgccgccgccctcgcacccgcacccgcacccgccgcccgcg
cacctggccgccccgcacctgcagttccagatcgcgcactgcggccagaccaccatgcac
ctgcagcccggtcaccccacgccgccgcccacgcccgtgcccagcccgcaccccgcgccc
gcgctcggtgccgccggcctgccgggccctggcagcgcgctcaaggggctgggcgccgcg
caccccgacctccgcgcgagtggcggcagcggcgcgggcaaggccaagaagtcggtggac
aagaacagcaacgagtaccgggtgcggcgcgagcgcaacaacatcgcggtgcgcaagagc
cgcgacaaggccaagcagcgcaacgtggagacgcagcagaaggtgctggagctgaccagt
gacaatgaccgcctgcgcaagcgggtggaacagctgagccgcgaactggacacgctgcgg
ggcatcttccgccagctgccagagagctccttggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system