KEGG   Homo sapiens (human): 10521Help
Entry
10521             CDS       T01001                                 

Gene name
DDX17, P72, RH70
Definition
(RefSeq) DEAD-box helicase 17 (EC:3.6.4.13)
  KO
K13178  
ATP-dependent RNA helicase DDX17 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     10521 (DDX17)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    10521 (DDX17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 729 aa AA seqDB search
MPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQ
ALPSPAIRAPLPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKK
KWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQ
YVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLE
RGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIA
TPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP
KEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENK
TIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASR
GLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEA
NQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSA
SYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTY
GASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPP
PPPPPPSRK
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
ctgcccaccggctttgtagccccgattctctgtgttttgctcccgtctccgacgagagag
gcggcgacggtggcgtctgcgacgggagacagcgcgtcggagcgagagagcgctgcgcct
gccgccgccccaacagcggaggcgccgccgccatcggtcgtcaccagaccggagccgcag
gccctcccgagcccggccatccgtgccccgctcccagatctctatccttttgggaccatg
cgcggaggaggctttggggaccgggaccgggatcgtgaccgtggaggatttggagcaaga
ggtggtggtggccttcccccgaagaaatttggtaatcctggggagcgtttgcgtaaaaaa
aagtgggatttgagtgagctccccaagtttgagaaaaatttttatgtggaacatccggaa
gtagcaaggctgacaccatatgaggttgatgagctacgccgaaagaaggagattacagtg
agggggggagatgtttgtcctaaacccgtgtttgccttccatcatgctaacttcccacaa
tatgtaatggatgtgttgatggatcagcactttacagaaccaactccaattcagtgccag
ggatttccgttggctcttagtggccgggatatggtgggcattgctcagactggctctggg
aagacgttggcgtatctcctgcctgcaattgttcatattaaccaccagccatacttggaa
aggggagatggcccaatctgtctagttctggctcctaccagagagcttgcccagcaagta
cagcaggtggccgatgactatggcaaatgttctagattgaagagtacttgtatttatgga
ggtgctcctaaaggtccccagattcgagacttggaaagaggtgttgagatctgcatagcc
actcctggacgtctgatagatttcctggagtcaggaaagacaaatcttcgccgatgtact
taccttgtattggacgaagctgacagaatgcttgatatggggtttgaaccccagatccgt
aaaattgttgaccaaatcaggcctgataggcagacactgatgtggagtgcaacctggcca
aaagaagtaagacagcttgcagaggatttccttcgtgattacacccagatcaacgtaggc
aatctggagttgagtgccaaccacaacatcctccagatagtggatgtctgcatggaaagt
gaaaaagaccacaagttgatccaactaatggaagaaataatggctgaaaaggaaaacaaa
acaataatatttgtggagacaaagagacgctgtgatgatctgactcgaaggatgcgcaga
gatggttggccagctatgtgtatccatggagacaagagtcaaccagaaagagattgggta
cttaatgagttccgttctggaaaggcacccatccttattgctacagatgtagcctcccgt
gggctagatgtggaagatgtcaagtttgtgatcaactatgactatccaaacagctcagag
gattatgtgcaccgtattggccgaacagcccgtagcaccaacaagggtaccgcctatacc
ttcttcaccccagggaacctaaaacaggccagagagcttatcaaagtgctggaagaggcc
aatcaggctatcaatccaaaactgatgcagcttgtggaccacagaggaggcggcggaggc
gggggtggtcgttctcgttaccggaccacttcttcagccaacaatcccaatctgatgtat
caggatgagtgtgaccgaaggcttcgaggagtcaaggatggtggccggagagactctgca
agctatcgggatcgtagtgaaaccgatagagctggttatgctaatggcagtggctatgga
agtccaaattctgcctttggagcacaagcaggccaatacacctatggtcaaggcacctat
ggggcagctgcttatggcaccagtagctatacagctcaagaatatggtgctggcacttat
ggagctagtagcaccacctcaactgggagaagttcacagagctctagccagcagtttagt
gggataggccggtctgggcagcagccacagccactgatgtcacaacagtttgcacagcct
ccgggagctaccaatatgataggttacatggggcagactgcctaccaataccctcctcct
cctccccctcctcctccttcacgtaaatga

DBGET integrated database retrieval system