KEGG   Homo sapiens (human): 10574Help
Entry
10574             CDS       T01001                                 

Gene name
CCT7, CCTETA, CCTH, NIP7-1, TCP1ETA
Definition
(RefSeq) chaperonin containing TCP1 subunit 7
  KO
K09499  
T-complex protein 1 subunit eta
Organism
hsa  Homo sapiens (human)
Brite
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   10574 (CCT7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10574 (CCT7)
  Exosomal proteins of colorectal cancer cells
   10574 (CCT7)
  Exosomal proteins of bladder cancer cells
   10574 (CCT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.2
AA seq 543 aa AA seqDB search
MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISN
DGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQI
IIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVV
DAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALL
NVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVAT
QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNF
FTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDIN
NEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRG
RPH
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccacaccagttatcctattgaaagaggggactgatagctcccaaggcatcccc
cagcttgtgagtaacatcagtgcctgccaggtgattgctgaggctgtaagaactaccctg
ggtccccgtggcatggacaagcttattgtagatggcagaggcaaagcaacaatttctaat
gatggggccacaattctgaaacttcttgatgttgtccatcctgcagcaaagactttggta
gacattgccaaatcccaagatgctgaggtgggtgatggcaccacctcagtgaccttgctg
gctgcagagtttctgaagcaggtgaaaccctatgtggaggaaggtttacacccccagatc
atcattcgagctttccgcacagccacccagctggcagttaacaagatcaaagagattgct
gtgaccgtgaagaaggcagataaagtggagcagaggaagctgctggaaaagtgtgccatg
accgctctgagctccaagctgatctcccagcagaaagctttctttgctaagatggtggtg
gatgcagtgatgatgctcgatgatttgctgcagcttaaaatgattggaatcaagaaggta
cagggtggagccctcgaggattctcagctggtagctggtgttgcattcaagaagactttc
tcttacgctgggtttgaaatgcaacccaaaaagtaccacaatcccaagattgcccttttg
aatgtcgagctcgagttgaaagctgagaaagacaatgctgagataagagtccacacagtt
gaggattatcaggcaattgttgatgctgagtggaacattctctatgacaagttagagaag
atccatcattctggagccaaagttgtcttgtccaaactccccattggggatgtggccacc
cagtactttgctgacagggacatgttctgtgctggccgagtacctgaggaggatctgaag
aggacaatgatggcctgtggaggctcaatccagaccagtgtgaatgctctgtcagcagat
gtgctgggtcgatgccaggtgtttgaagagacccagattggaggcgagaggtacaatttt
tttactggctgccccaaggccaagacatgcaccttcattctccgtggcggcgccgagcag
tttatggaggagacagagcggtccctgcatgatgccatcatgatcgtcaggagggccatc
aagaatgattcagtggtggctggtggcggggccattgagatggaactctccaagtacctg
cgggattactcaaggactattccaggaaaacagcagctgttgattggggcatatgccaag
gccttggagattatcccacgccagctgtgtgacaatgctggctttgatgccacaaacatt
ctcaacaagctgcgggctcggcatgcccaggggggtacatggtatggagtagacatcaac
aacgaggacattgctgacaactttgaagctttcgtgtgggagccagctatggtgcggatc
aatgcgctgacagcagcctctgaggctgcgtgcctgatcgtgtctgtagatgaaaccatc
aagaacccccgctcgactgtggatgctcccacagcagcaggccggggccgtggtcgtggc
cgcccccactga

DBGET integrated database retrieval system