KEGG   Homo sapiens (human): 10683Help
Entry
10683             CDS       T01001                                 

Gene name
DLL3, SCDO1
Definition
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  
delta
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Notch signaling pathway
Th1 and Th2 cell differentiation
Breast cancer
Module
Notch signaling
Disease
H00517  
Spondylocostal dysostosis (SCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    10683 (DLL3)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    10683 (DLL3)
 Human Diseases
  Cancers
   05224 Breast cancer
    10683 (DLL3)
  Drug resistance
   01522 Endocrine resistance
    10683 (DLL3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 6. Sialomucin Family
  GLG1, ESL1; golgi apparatus protein 1 [KO:K06816]
   10683 (DLL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 618 aa AA seqDB search
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA
GQRQHLLFPYPSSILSVK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggtctccccacggatgtccgggctcctctcccagactgtgatcctagcgctcattttc
ctcccccagacacggcccgctggcgtcttcgagctgcagatccactctttcgggccgggt
ccaggccctggggccccgcggtccccctgcagcgcccggctcccctgccgcctcttcttc
agagtctgcctgaagcctgggctctcagaggaggccgccgagtccccgtgcgccctgggc
gcggcgctgagtgcgcgcggaccggtctacaccgagcagcccggagcgcccgcgcctgat
ctcccactgcccgacggcctcttgcaggtgcccttccgggacgcctggcctggcaccttc
tctttcatcatcgaaacctggagagaggagttaggagaccagattggagggcccgcctgg
agcctgctggcgcgcgtggctggcaggcggcgcttggcagccggaggcccgtgggcccgg
gacattcagcgcgcaggcgcctgggagctgcgcttctcgtaccgcgcgcgctgcgagccg
cctgccgtcgggaccgcgtgcacgcgcctctgccgtccgcgcagcgccccctcgcggtgc
ggtccgggactgcgcccctgcgcaccgctcgaggacgaatgtgaggcgccgctggtgtgc
cgagcaggctgcagccctgagcatggcttctgtgaacagcccggtgaatgccgatgccta
gagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctcagcccc
aggggcccgtcctctgctaccaccggatgccttgtccctgggcctgggccctgtgacggg
aacccgtgtgccaatggaggcagctgtagtgagacacccaggtcctttgaatgcacctgc
ccgcgtgggttctacgggctgcggtgtgaggtgagcggggtgacatgtgcagatggaccc
tgcttcaacggcggcttgtgtgtcgggggtgcagaccctgactctgcctacatctgccac
tgcccacccggtttccaaggctccaactgtgagaagagggtggaccggtgcagcctgcag
ccatgccgcaatggcggactctgcctggacctgggccacgccctgcgctgccgctgccgc
gccggcttcgcgggtcctcgctgcgagcacgacctggacgactgcgcgggccgcgcctgc
gctaacggcggcacgtgtgtggagggcggcggcgcgcaccgctgctcctgcgcgctgggc
ttcggcggccgcgactgccgcgagcgcgcggacccgtgcgccgcgcgcccctgtgctcac
ggcggccgctgctacgcccacttctccggcctcgtctgcgcttgcgctcccggctacatg
ggagcgcggtgtgagttcccagtgcaccccgacggcgcaagcgccttgcccgcggccccg
ccgggcctcaggcccggggaccctcagcgctaccttttgcctccggctctgggactgctc
gtggccgcgggcgtggccggcgctgcgctcttgctggtccacgtgcgccgccgtggccac
tcccaggatgctgggtctcgcttgctggctgggaccccggagccgtcagtccacgcactc
ccggatgcactcaacaacctaaggacgcaggagggttccggggatggtccgagctcgtcc
gtagattggaatcgccctgaagatgtagaccctcaagggatttatgtcatatctgctcct
tccatctacgctcgggaggtagcgacgccccttttccccccgctacacactgggcgcgct
gggcagaggcagcacctgctttttccctacccttcctcgattctgtccgtgaaatga

DBGET integrated database retrieval system