KEGG   Homo sapiens (human): 10758Help
Entry
10758             CDS       T01001                                 

Gene name
TRAF3IP2, ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CANDF8, CIKS, PSORS13
Definition
TRAF3 interacting protein 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 564 aa AA seqDB search
MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDF
SQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASES
VVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQR
PQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFE
PQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLP
GASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNRAGAPGESLE
CPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVN
FLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDTVMIIVAISPKYKQDVEGAESQLDEDE
HGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILL
RLLREEEYVAPPRGPLPTLQVVPL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaagcattcctgtggaggttgatgaatcagaaccatacccaagtcagttgctg
aaaccaatcccagaatattccccggaagaggaatcagaaccacctgctccaaatataagg
aacatggcacccaacagcttgtctgcacccacaatgcttcacaattcctccggagacttt
tctcaagctcactcaaccctgaaacttgcaaatcaccagcggcctgtatcccggcaggtc
acctgcctgcgcactcaagttctggaggacagtgaagacagtttctgcaggagacaccca
ggcctgggcaaagctttcccttctgggtgctctgcagtcagcgagcctgcgtctgagtct
gtggttggagccctccctgcagagcatcagttttcatttatggaaaaacgtaatcaatgg
ctggtatctcagctttcagcggcttctcctgacactggccatgactcagacaaatcagac
caaagtttacctaatgcctcagcagactccttgggcggtagccaggagatggtgcaacgg
ccccagcctcacaggaaccgagcaggcctggatctgccaaccatagacacgggatatgat
tcccagccccaggatgtcctgggcatcaggcagctggaaaggcccctgcccctcacctcc
gtgtgttacccccaggacctccccagacctctcaggtccagggagttccctcagtttgaa
cctcagaggtatccagcatgtgcacagatgctgcctcccaatctttccccacatgctcca
tggaactatcattaccattgtcctggaagtcccgatcaccaggtgccatatggccatgac
taccctcgagcagcctaccagcaagtgatccagccggctctgcctgggcagcccctgcct
ggagccagtgtgagaggcctgcaccctgtgcagaaggttatcctgaattatcccagcccc
tgggaccacgaagagaggcccgcacagagagactgctcctttccggggcttccaaggcac
caggaccagccacatcaccagccacctaatagagctggtgctcctggggagtccttggag
tgccctgcagagctgagaccacaggttccccagcctccgtccccagctgctgtgcctaga
ccccctagcaaccctccagccagaggaactctaaaaacaagcaatttgccagaagaattg
cggaaagtctttatcacttattcgatggacacagctatggaggtggtgaaattcgtgaac
tttttgttggtaaatggcttccaaactgcaattgacatatttgaggatagaatccgaggc
attgatatcattaaatggatggagcgctaccttagggataccgtgatgataatcgtagca
atcagccccaaatacaaacaggacgtggaaggcgctgagtcgcagctggacgaggatgag
catggcttacatactaagtacattcatcgaatgatgcagattgagttcataaaacaagga
agcatgaatttcagattcatccctgtgctcttcccaaatgctaagaaggagcatgtgccc
acctggcttcagaacactcatgtctacagctggcccaagaataaaaaaaacatcctgctg
cggctgctgagagaggaagagtatgtggctcctccacgggggcctctgcccacccttcag
gtggttcccttgtga

DBGET integrated database retrieval system