KEGG   Homo sapiens (human): 10758Help
Entry
10758             CDS       T01001                                 

Gene name
TRAF3IP2, ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CANDF8, CIKS, PSORS13
Definition
(RefSeq) TRAF3 interacting protein 2
  KO
K21124  adaptor protein CIKS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    10758 (TRAF3IP2)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    10758 (TRAF3IP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SEFIR TIR_2
Motif
Other DBs
NCBI-GeneID: 10758
NCBI-ProteinID: NP_671733
OMIM: 607043
HGNC: 1343
Ensembl: ENSG00000056972
Vega: OTTHUMG00000015379
Pharos: O43734(Tbio)
UniProt: O43734
Position
6q21
AA seq 574 aa AA seqDB search
MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPT
MLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCS
AVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSL
GGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPL
RSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
PALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNR
AGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVE
GAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYS
WPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagcttcaagaaactagaatgaaccgaagcattcctgtggaggttgatgaa
tcagaaccatacccaagtcagttgctgaaaccaatcccagaatattccccggaagaggaa
tcagaaccacctgctccaaatataaggaacatggcacccaacagcttgtctgcacccaca
atgcttcacaattcctccggagacttttctcaagctcactcaaccctgaaacttgcaaat
caccagcggcctgtatcccggcaggtcacctgcctgcgcactcaagttctggaggacagt
gaagacagtttctgcaggagacacccaggcctgggcaaagctttcccttctgggtgctct
gcagtcagcgagcctgcgtctgagtctgtggttggagccctccctgcagagcatcagttt
tcatttatggaaaaacgtaatcaatggctggtatctcagctttcagcggcttctcctgac
actggccatgactcagacaaatcagaccaaagtttacctaatgcctcagcagactccttg
ggcggtagccaggagatggtgcaacggccccagcctcacaggaaccgagcaggcctggat
ctgccaaccatagacacgggatatgattcccagccccaggatgtcctgggcatcaggcag
ctggaaaggcccctgcccctcacctccgtgtgttacccccaggacctccccagacctctc
aggtccagggagttccctcagtttgaacctcagaggtatccagcatgtgcacagatgctg
cctcccaatctttccccacatgctccatggaactatcattaccattgtcctggaagtccc
gatcaccaggtgccatatggccatgactaccctcgagcagcctaccagcaagtgatccag
ccggctctgcctgggcagcccctgcctggagccagtgtgagaggcctgcaccctgtgcag
aaggttatcctgaattatcccagcccctgggaccacgaagagaggcccgcacagagagac
tgctcctttccggggcttccaaggcaccaggaccagccacatcaccagccacctaataga
gctggtgctcctggggagtccttggagtgccctgcagagctgagaccacaggttccccag
cctccgtccccagctgctgtgcctagaccccctagcaaccctccagccagaggaactcta
aaaacaagcaatttgccagaagaattgcggaaagtctttatcacttattcgatggacaca
gctatggaggtggtgaaattcgtgaactttttgttggtaaatggcttccaaactgcaatt
gacatatttgaggatagaatccgaggcattgatatcattaaatggatggagcgctacctt
agggataagaccgtgatgataatcgtagcaatcagccccaaatacaaacaggacgtggaa
ggcgctgagtcgcagctggacgaggatgagcatggcttacatactaagtacattcatcga
atgatgcagattgagttcataaaacaaggaagcatgaatttcagattcatccctgtgctc
ttcccaaatgctaagaaggagcatgtgcccacctggcttcagaacactcatgtctacagc
tggcccaagaataaaaaaaacatcctgctgcggctgctgagagaggaagagtatgtggct
cctccacgggggcctctgcccacccttcaggtggttcccttgtga

DBGET integrated database retrieval system