KEGG   Homo sapiens (human): 10801Help
Entry
10801             CDS       T01001                                 

Gene name
SEPT9, AF17q25, MSF, MSF1, NAPB, PNUTL4, SINT1, SeptD1
Definition
(RefSeq) septin 9
  KO
K16938  septin 3/9/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
Disease
H01131  Hereditary neuralgic amyotrophy (HNA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    10801 (SEPT9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     10801 (SEPT9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10801 (SEPT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 GTP_EFTU Dynamin_N Roc Ras FtsK_SpoIIIE AAA_16 AAA_22 ABC_tran G-alpha AAA_24 IIGP AAA_29 PduV-EutP NB-ARC IstB_IS21 Arf Gtr1_RagA Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 10801
NCBI-ProteinID: NP_001106963
OMIM: 604061
HGNC: 7323
Ensembl: ENSG00000184640
Vega: OTTHUMG00000177327
Pharos: Q9UHD8(Tbio)
UniProt: Q9UHD8
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 586 aa AA seqDB search
MKKSYSGGTRTSSGRLRRLGDSSGPALKRSFEVEEVETPNSTPPRRVQTPLLRATVASST
QKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVE
NAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESAHRRMEPPASKVPEVPTAPA
TDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQE
ATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFN
IMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTV
IDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGH
SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDE
DSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLL
IRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtcttactcaggaggcacgcggacctccagtggccggctccggaggcttggt
gactccagtggcccagccttgaaaagatcttttgaggtcgaggaggtcgagacacccaac
tccaccccaccccggagggtccagactcccctactccgagccactgtggccagctccacc
cagaaattccaggacctgggcgtgaagaactcagaaccctcggcccgccatgtggactcc
ctaagccaacgctcccccaaggcgtccctgcggagggtggagctctcgggccccaaggcg
gccgagccggtgtcccggcgcactgagctgtccattgacatctcgtccaagcaggtggag
aacgccggggccatcggcccgtcccggttcgggctcaagagggccgaggtgttgggccac
aagacgccagaaccggcccctcggaggacggagatcaccatcgtcaaaccccaggagtca
gcccaccggaggatggagccccctgcctccaaggtccccgaggtgcccactgcccctgcc
accgacgcagcccccaagagggtggagatccagatgcccaagcctgctgaggcgcccacc
gcccccagcccagcccagaccttggagaattcagagcctgcccctgtgtctcagctgcag
agcaggctggagcccaagccccagccccctgtggctgaggctacaccccggagccaggag
gccactgaggcggctcccagctgcgttggcgacatggccgacacccccagagatgccggg
ctcaagcaggcgcctgcatcacggaacgagaaggccccggtggacttcggctacgtgggg
attgactccatcctggagcagatgcgccggaaggccatgaagcagggcttcgagttcaac
atcatggtggtcgggcagagcggcttgggtaaatccaccttaatcaacaccctcttcaaa
tccaaaatcagccggaagtcggtgcagcccacctcagaggagcgcatccccaagaccatc
gagatcaagtccatcacgcacgatattgaggagaaaggcgtccggatgaagctgacagtg
attgacacaccagggttcggggaccacatcaacaacgagaactgctggcagcccatcatg
aagttcatcaatgaccagtacgagaaatacctgcaggaggaggtcaacatcaaccgcaag
aagcgcatcccggacacccgcgtccactgctgcctctacttcatccccgccaccggccac
tccctcaggcccctggacatcgagtttatgaaacgcctgagcaaggtggtcaacatcgtc
cctgtcatcgccaaggcggacacactcaccctggaggagagggtccacttcaaacagcgg
atcaccgcagacctgctgtccaacggcatcgacgtgtacccccagaaggaatttgatgag
gactcggaggaccggctggtgaacgagaagttccgggagatgatcccatttgctgtggtg
ggcagtgaccacgagtaccaggtcaacggcaagaggatccttgggaggaagaccaagtgg
ggtaccatcgaagttgaaaacaccacacactgtgagtttgcctacctgcgggaccttctc
atcaggacgcacatgcagaacatcaaggacatcaccagcagcatccacttcgaggcgtac
cgtgtgaagcgcctcaacgagggcagcagcgccatggccaacggcatggaggagaaggag
ccagaagccccggagatgtag

DBGET integrated database retrieval system