KEGG   Homo sapiens (human): 10801Help
Entry
10801             CDS       T01001                                 

Gene name
SEPT9, AF17q25, MSF, MSF1, NAPB, PNUTL4, SINT1, SeptD1
Definition
septin 9
Orthology
K16938  
septin 3/9/12
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Disease
H01131  
Hereditary neuralgic amyotrophy (HNA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    10801 (SEPT9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10801 (SEPT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25
AA seq 586 aa AA seqDB search
MKKSYSGGTRTSSGRLRRLGDSSGPALKRSFEVEEVETPNSTPPRRVQTPLLRATVASST
QKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVE
NAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESAHRRMEPPASKVPEVPTAPA
TDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQE
ATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFN
IMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTV
IDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGH
SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDE
DSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLL
IRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtcttactcaggaggcacgcggacctccagtggccggctccggaggcttggt
gactccagtggcccagccttgaaaagatcttttgaggtcgaggaggtcgagacacccaac
tccaccccaccccggagggtccagactcccctactccgagccactgtggccagctccacc
cagaaattccaggacctgggcgtgaagaactcagaaccctcggcccgccatgtggactcc
ctaagccaacgctcccccaaggcgtccctgcggagggtggagctctcgggccccaaggcg
gccgagccggtgtcccggcgcactgagctgtccattgacatctcgtccaagcaggtggag
aacgccggggccatcggcccgtcccggttcgggctcaagagggccgaggtgttgggccac
aagacgccagaaccggcccctcggaggacggagatcaccatcgtcaaaccccaggagtca
gcccaccggaggatggagccccctgcctccaaggtccccgaggtgcccactgcccctgcc
accgacgcagcccccaagagggtggagatccagatgcccaagcctgctgaggcgcccacc
gcccccagcccagcccagaccttggagaattcagagcctgcccctgtgtctcagctgcag
agcaggctggagcccaagccccagccccctgtggctgaggctacaccccggagccaggag
gccactgaggcggctcccagctgcgttggcgacatggccgacacccccagagatgccggg
ctcaagcaggcgcctgcatcacggaacgagaaggccccggtggacttcggctacgtgggg
attgactccatcctggagcagatgcgccggaaggccatgaagcagggcttcgagttcaac
atcatggtggtcgggcagagcggcttgggtaaatccaccttaatcaacaccctcttcaaa
tccaaaatcagccggaagtcggtgcagcccacctcagaggagcgcatccccaagaccatc
gagatcaagtccatcacgcacgatattgaggagaaaggcgtccggatgaagctgacagtg
attgacacaccagggttcggggaccacatcaacaacgagaactgctggcagcccatcatg
aagttcatcaatgaccagtacgagaaatacctgcaggaggaggtcaacatcaaccgcaag
aagcgcatcccggacacccgcgtccactgctgcctctacttcatccccgccaccggccac
tccctcaggcccctggacatcgagtttatgaaacgcctgagcaaggtggtcaacatcgtc
cctgtcatcgccaaggcggacacactcaccctggaggagagggtccacttcaaacagcgg
atcaccgcagacctgctgtccaacggcatcgacgtgtacccccagaaggaatttgatgag
gactcggaggaccggctggtgaacgagaagttccgggagatgatcccatttgctgtggtg
ggcagtgaccacgagtaccaggtcaacggcaagaggatccttgggaggaagaccaagtgg
ggtaccatcgaagttgaaaacaccacacactgtgagtttgcctacctgcgggaccttctc
atcaggacgcacatgcagaacatcaaggacatcaccagcagcatccacttcgaggcgtac
cgtgtgaagcgcctcaacgagggcagcagcgccatggccaacggcatggaggagaaggag
ccagaagccccggagatgtag

DBGET integrated database retrieval system