KEGG   Homo sapiens (human): 10841Help
Entry
10841             CDS       T01001                                 

Gene name
FTCD, LCHC1
Definition
formimidoyltransferase cyclodeaminase (EC:2.1.2.5 4.3.1.4)
Orthology
K13990  
glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase [EC:2.1.2.5 4.3.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Histidine metabolism
One carbon pool by folate
Metabolic pathways
Disease
H01262  
Formiminotransferase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    10841 (FTCD)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    10841 (FTCD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.5  glutamate formimidoyltransferase
     10841 (FTCD)
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.4  formimidoyltetrahydrofolate cyclodeaminase
     10841 (FTCD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10841 (FTCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 541 aa AA seqDB search
MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
GALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELD
VPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARK
FLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLD
FEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRI
RLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVA
AAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYL
EAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDL
QVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQ
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctggtggaatgcgtccccaacttttcggaggggaagaaccaggaggtgatc
gacgccatctctggagccatcacacagaccccgggctgcgtgctgctggatgtggacgca
ggcccttccaccaaccgcaccgtgtacaccttcgtggggccgccggagtgcgtggtggag
ggggccctcaacgctgcccgggtagcttcccgacttatcgacatgagcaggcaccaagga
gagcacccccgcatgggggccctagacgtctgccccttcatccccgtgaggggcgtcagc
gtggatgagtgtgtgctctgcgcccaggcctttggccagaggctggcagaggagctggac
gtgccagtttacctgtacggcgaggcagccaggatggacagtcgccggaccctgccggcc
atccgggccggggagtacgaggccctccctaagaagctccagcaggccgactgggcgccc
gactttggtcccagctcctttgtccccagttggggggccacggccacgggggcgaggaag
ttcctcattgcttttaacatcaacctgctcggcacaaaggagcaagcccaccgcatcgcg
ctcaacctgcgggagcagggccgcgggaaggaccagccaggacgtctgaagaaagttcag
ggcattggctggtacctggatgagaagaacctggctcaggtgtccaccaatcttctggac
tttgaggtcacggcactgcacacggtctacgaggagacctgccgagaagcacaggagctg
agcctcccagtggtgggctcacagctggtgggcctggtgcccctgaaggctctgctggat
gcggccgccttctactgcgagaaggagaacctcttcatcctggaggaggagcagcggatc
aggctggtggtgagccggctgggcctggactccctgtgccccttcagccctaaggagcgg
atcatcgagtacctggtccctgagcgcgggcctgagcgaggcctgggcagcaagtccctg
cgcgccttcgtgggggaggtgggtgcccgctctgcggcccccgggggcggctcggtggcg
gcggccgctgcggccatgggtgcggcgctgggctccatggtgggcctcatgacctacggg
cggcgccaattccagtccctggacacgacgatgcggcgcctgatcccgcccttccgcgag
gcttcggccaagctaaccacgctggtggatgccgacgccgaggccttcaccgcctacctg
gaagcaatgaggctccccaagaacacacctgaggaaaaggacaggcgcacggcggcccta
caggagggtctgaggcgggcagtctctgtgccgctgacgctggcggagacggtggcctcg
ctgtggccggccctgcaggaactggcccggtgtgggaacctggcctgccggtcagacctc
caggtggcggccaaagccctggagatgggcgtgtttggcgcatatttcaacgtgctcatc
aacctgagggacatcacagacgaggcatttaaggaccagatccaccatcgtgtttccagc
ctcctgcaggaagccaagacccaggctgcactggtgctggactgcttggagacccggcag
gagtga

DBGET integrated database retrieval system