KEGG   Homo sapiens (human): 10847Help
Entry
10847             CDS       T01001                                 

Gene name
SRCAP, DOMO1, EAF1, FLHS, SWR1
Definition
Snf2-related CREBBP activator protein
Orthology
K11661  
helicase SRCAP [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 3230 aa AA seqDB search
MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGP
PGPPDGATVPLEGFSLSQAADLANKGPKWEKSHAEIAEQAKHEAEIETRIAELRKEGFWS
LKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE
ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQT
EKYSDLLSQSLNQPLTSSKAGSSPCLGSSSAASSPPPPASRLDDEDGDFQPQEDEEEDDE
ETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSD
TRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAE
EQLEGEVDHAMELSELAREGELSMEELLQQYAGAYAPGSGSSEDEDEDEVDANSSDCEPE
GPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQA
DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYT
LATTQVKTPIPLLLRGQLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHL
ACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYYGAQKERKLKRQGWTKPNAFHV
CITSYKLVLQDHQAFRRKNWRYLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQN
SLMELWSLMHFLMPHVFQSHREFKEWFSNPLTGMIEGSQEYNEGLVKRLHKVLRPFLLRR
VKVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQTTTKETLATGHFMSVINILMQLRKV
CNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQRIDMGRFDLIGLEGRVSRYEA
DTFLPRHRLSRRVLLEVATAPDPPPRPKPVKMKVNRMLQPVPKQEGRTVVVVNNPRAPLG
PVPVRPPPGPELSAQPTPGPVPQVLPASLMVSASPAGPPLIPASRPPGPVLLPPLQPNSG
SLPQVLPSPLGVLSGTSRPPTPTLSLKPTPPAPVRLSPAPPPGSSSLLKPLTVPPGYTFP
PAAATTTSTTTATATTTAVPAPTPAPQRLILSPDMQARLPSGEVVSIGQLASLAQRPVAN
AGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQRNVVHLVSAGGQHHLISQPAHVALI
QAVAPTPGPTPVSVLPSSTPSTTPAPTGLSLPLAANQVPPTMVNNTGVVKIVVRQAPRDG
LTPVPPLAPAPRPPSSGLPAVLNPRPTLTPGRLPTPTLGTARAPMPTPTLVRPLLKLVHS
PSPEVSASAPGAAPLTISSPLHVPSSLPGPASSPMPIPNSSPLASPVSSTVSVPLSSSLP
ISVPTTLPAPASAPLTIPISAPLTVSASGPALLTSVTPPLAPVVPAAPGPPSLAPSGASP
SASALTLGLATAPSLSSSQTPGHPLLLAPTSSHVPGLNSTVAPACSPVLVPASALASPFP
SAPNPAPAQASLLAPASSASQALATPLAPMAAPQTAILAPSPAPPLAPLPVLAPSPGAAP
VLASSQTPVPVMAPSSTPGTSLASASPVPAPTPVLAPSSTQTMLPAPVPSPLPSPASTQT
LALAPALAPTLGGSSPSQTLSLGTGNPQGPFPTQTLSLTPASSLVPTPAQTLSLAPGPPL
GPTQTLSLAPAPPLAPASPVGPAPAHTLTLAPASSSASLLAPASVQTLTLSPAPVPTLGP
AAAQTLALAPASTQSPASQASSLVVSASGAAPLPVTMVSRLPVSKDEPDTLTLRSGPPSP
PSTATSFGGPRPRRQPPPPPRSPFYLDSLEEKRKRQRSERLERIFQLSEAHGALAPVYGT
EVLDFCTLPQPVASPIGPRSPGPSHPTFWTYTEAAHRAVLFPQQRLDQLSEIIERFIFVM
PPVEAPPPSLHACHPPPWLAPRQAAFQEQLASELWPRARPLHRIVCNMRTQFPDLRLIQY
DCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQA
LMERFNADKRIFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRD
VHIYRLISERTVEENILKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPSSS
SVPSAPEEEEETVASKQTHILEQALCRAEDEEDIRAATQAKAEQVAELAEFNENDGFPAG
EGEEAGRPGAEDEEMSRAEQEIAALVEQLTPIERYAMKFLEASLEEVSREELKQAEEQVE
AARKDLDQAKEEVFRLPQEEEEGPGAGDESSCGTGGGTHRRSKKAKAPERPGTRVSERLR
GARAETQGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASAPAAIPALVPV
PVSAPVPISAPNPITILPVHILPSPPPPSQIPPCSSPACTPPPACTPPPAHTPPPAQTCL
VTPSSPLLLGPPSVPISASVTNLPLGLRPEAELCAQALASPESLELASVASSETSSLSLV
PPKDLLPVAVEILPVSEKNLSLTPSAPSLTLEAGSIPNGQEQEAPDSAEGTTLTVLPEGE
ELPLCVSESNGLELPPSAASDEPLQEPLEADRTSEELTEAKTPTSSPEKPQELVTAEVAA
PSTSSSATSSPEGPSPARPPRRRTSADVEIRGQGTGRPGQPPGPKVLRKLPGRLVTVVEE
KELVRRRRQQRGAASTLVPGVSETSASPGSPSVRSMSGPESSPPIGGPCEAAPSSSLPTP
PQQPFIARRHIELGVTGGGSPENGDGALLAITPPAVKRRRGRPPKKNRSPADAGRGVDEA
PSSTLKGKTNGADPVPGPETLIVADPVLEPQLIPGPQPLGPQPVHRPNPLLSPVEKRRRG
RPPKARDLPIPGTISSAGDGNSESRTQPPPHPSPLTPLPPLLVCPTATVANTVTTVTIST
SPPKRKRGRPPKNPPSPRPSQLPVLDRDSTSVLESCGLGRRRQPQGQGESEGSSSDEDGS
RPLTRLARLRLEAEGMRGRKSGGSMVVAVIQDDLDLADSGPGGLELTPPVVSLTPKLRST
RLRPGSLVPPLETEKLPRKRAGAPVGGSPGLAKRGRLQPPSPLGPEGSVEESEAEASGEE
EEGDGTPRRRPGPRRLVGTTNQGDQRILRSSAPPSLAGPAVSHRGRKAKT
NT seq 9693 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcagcccctcccctgctcaccctcagctcccagtcctacagacacagatggtg
tcggacggcatgacaggcagcaatcctgtgtcccctgcctcatccagttccccagcctct
agtggggcaggcggcatctccccgcagcacatagctcaagattcctcactggatggacct
ccaggccccccagatggtgccacagtgcccctggaggggttcagcttatcccaggctgct
gacctggctaacaagggcccgaagtgggagaagagccatgccgaaattgcagaacaggcc
aagcatgaggccgagatcgagactcggattgctgagctgcggaaggagggtttctggtca
ctgaagaggctgcctaaggtgccagagccccctcgccccaaaggtcactgggactatttg
tgcgaagagatgcagtggctctctgctgactttgctcaggagcgccgttggaaacggggt
gtggcccggaaggtggtgcgcatggtgatccggcaccacgaggagcagcggcagaaagag
gaacgggcccggagggaggagcaggccaagctgcgtcgaattgcttccaccatggccaag
gatgtcaggcagttctggagcaatgtggagaaggtggtgcaattcaagcaacagtcccgg
cttgaggaaaagcgcaaaaaagccctggacctgcatttggacttcattgtggggcaaact
gaaaagtactcggaccttctgtctcagagcctcaaccagccattaacctccagcaaagca
ggctcttccccttgcctcggctcttcctcagctgcctccagtcctccaccccctgcttct
cgcctggatgatgaagatggggactttcaaccccaagaggatgaggaagaggatgatgag
gaaacgattgaagttgaagaacaacaggaaggcaatgatgcagaggcccagaggcgtgag
attgagctgcttcgccgtgagggagaattgccactggaagagctgctccgttcccttccc
cctcagctgttggaagggccttccagcccctctcaaaccccctcatctcatgatagtgac
acccgagatgggcctgaagaaggtgctgaagaagagccccctcaggtgttggagataaag
cccccaccctctgctgtcacacagcgcaacaaacagccttggcatccagatgaagatgat
gaagagtttactgccaacgaagaggaagcggaggatgaagaggatactatagcagctgag
gaacagttggaaggggaggtggatcatgccatggagctgagcgagttggctcgagaaggt
gagctttccatggaggagctattgcagcagtatgcaggagcctatgccccaggctctggg
agcagtgaagatgaggatgaagatgaggttgatgctaatagctctgactgtgaaccagag
gggcccgtggaagcggaagagcctcctcaggaggatagtagcagtcagtcagactctgtg
gaggaccggagtgaggatgaggaagatgaacattcagaggaggaagaaacaagtggaagt
tcagcatcagaggaatctgagtctgaagagtctgaggatgcccaatcacagagccaagca
gatgaagaggaggaagatgatgattttggggtggagtacttgcttgccagggatgaagag
cagagtgaggcagatgcaggcagtgggcctcctactccagggcccactactctaggtcca
aagaaagaaattactgacattgctgcagcagctgaaagtctccagcccaagggttacacg
ctggccacgacccaggtaaagacgcccattcccctgcttctgcggggccagctccgggag
taccagcacattgggctagactggctggttaccatgtatgagaagaagcttaatggcatt
cttgctgatgagatggggcttgggaagaccatccagaccatctctctgcttgcccacttg
gcttgtgagaaaggtaactggggtccccatttaatcattgttcccaccagcgtgatgttg
aactgggagatggagttgaaacgttggtgccccagctttaaaatcctcacttactatgga
gcccagaaagagaggaagctcaagcggcagggctggaccaagcccaatgcctttcatgtg
tgtatcacatcttacaagctggtgctgcaggaccaccaggccttccgtcgcaagaactgg
cgctatctcattctggatgaggcgcagaacatcaagaacttcaagtcacagcgctggcag
tcactcctcaacttcaacagccagagacgcctgctcctgacaggaactcccttgcagaac
agcctcatggagctgtggtccttgatgcactttttgatgccccatgtcttccagtctcat
cgcgagttcaaggagtggttctctaatcccctaactggcatgattgagggcagccaagag
tataatgaaggtctagtcaaacgcctccacaaggttttgaggccttttttactgcgccga
gttaaggtggatgttgagaagcagatgcccaaaaagtacgagcatgttatccgctgcagg
ctctccaagcgtcaacgctgtctctatgatgacttcatggcacagaccacaactaaggag
acactagccacaggccatttcatgagcgtcatcaacattttgatgcagctgagaaaagtt
tgcaatcatccaaatctgttcgaccctcgaccggttacctcccctttcatcaccccaggc
atctgcttcagcaccgcctctctggtgctaagggccacggatgtccatcccctccagcgg
atagacatgggtcgatttgaccttattggcctggaaggtcgtgtctctcgatatgaggca
gacacatttctgccccggcaccgcctctctcgccgggtactgttagaagtggctactgct
cctgaccccccaccccggcccaagccagtcaagatgaaggtcaacaggatgctgcagcca
gtacctaagcaagaaggccggacagtggtggtggtgaacaacccacgggcgcccctgggc
cctgtcccagttcgacctcctccaggtcctgagctctcagcccagcccacccctggccca
gtcccccaagtgctgccagcatcactgatggtttcagcctcacctgccgggcccccgctt
attcctgcatctcggcctcctggccctgtcctcttgcctccactgcagcccaacagtggt
tctctcccccaggtgttgccatcccccctgggggtcctgagtgggacctcacggcctccc
acgccaaccttgtccctaaagccaacaccacctgccccagttcgcctgagcccagcccca
cctccaggctcctctagcctgttgaagcccctgacagtgccaccaggctacaccttccct
cctgctgctgccaccaccacttctaccaccacggcaactgctaccaccacagcagtgcca
gctccgactcctgcaccacagcgcctcattctatctcccgatatgcaggctcgcctgccc
tcaggcgaagtggtcagcatcgggcagttagcctcactggcacaacgtccagtggctaat
gcagggggaagcaaacctctcaccttccaaatccagggcaacaagctgactttgactggt
gcccaggtgcgccagcttgctgtggggcagccccgcccgctgcaaaggaatgtggtgcac
ctcgtgtcagcaggggggcagcaccatctcatcagccagcctgcccatgtggccctcatc
caggccgtggccccgacccctggccctacccctgtctctgtgctgccttcttcgaccccc
agcaccacccctgcccctactggcctcagccttccgcttgctgctaaccaggtgccacca
accatggtgaataatacaggcgtggtgaagattgtagtgagacaagcccctcgggatgga
ctgactcctgttcctccattggccccagcaccccggcctccgagctctgggcttccagct
gtgttgaatccacgccccacgttaacccctggccggctacccacacctactctgggtact
gctcgagcccccatgcccacacccactctggtgaggcctcttctcaagctggtccacagt
ccttcacctgaagtcagtgcttcagcccccggagctgcccccttgaccatctcttctcct
ctccacgtgccatcctcactccctgggccagcctcttctccaatgccaattcccaactcc
tctccccttgctagtcctgtgtcctctacagtctcagttccattgtcatcttcactcccc
atctctgtccccaccacacttcctgccccagcctcggctccactcaccatccccatctca
gcccccttgactgtttctgcttcgggcccagctctgttgaccagtgtgactccaccattg
gcacctgttgtcccagcggctcctggacctccctccttggcaccatctggtgcttccccg
tcagcatcagccttgactctaggtttggccacagctccatccctgtcttcatctcagaca
cctggtcaccctctgttgttggctcccacctcttcacatgttccagggttgaactcaacc
gtggccccagcatgctcacctgtcctggtgccagcttcggctctggccagtccttttccg
tcagcaccaaatccagctccagctcaggcttcccttctggctccagcatcttctgcatct
caggctctagccacccctctggctcctatggcggctccacagacagcaattctggctcct
tctccagctcctcctctggctcctcttccggtcctggcaccatcgccaggtgctgctcct
gtcctggcttcatcacagactccggttccagttatggctccatcgtctactccaggaacc
tctttagcctcagcttcaccggtaccagctccaacccctgtgttggctccatcatcaact
caaactatgctaccagccccggttccgtcacctctcccgagcccggcttctacgcagaca
ctggccctagccccagctttagcacccactcttggaggctcatctccatctcagacactc
tctttgggaacggggaacccccagggaccctttccaactcagacattgtcattaactcca
gcatcatccctggtaccaactccagcccagacactgtctttggcaccaggaccaccactg
ggtccaactcagacgctgtctctggctccagcaccccctctggctccagcttctccagtg
ggcccagccccagctcacacgctgactttggctccagcatcgtcatctgcttcactcctg
gccccagcttcagtgcagacactgaccttgagccctgccccagttcctaccctgggcccg
gccgcagctcagaccttggcgctggccccagcctccacacagtccccagcttcccaggca
tcttcccttgtggtttcggcatctggtgccgctcccttgcctgtcaccatggtatcccgg
ctgcctgtttccaaggatgagcctgacacactgacattgcgctctggtccccccagccct
ccctccactgctacctcgtttggtggcccccggcctcgacgccagccccccccaccacct
cgttcccctttttatctggactccctggaggaaaagcggaagcggcagcggtctgaacgc
ctggaacggattttccaacttagtgaggctcatggggccctggcacctgtgtatgggact
gaagtcctggatttctgtaccctgccccaacctgttgccagccccatcggccctcgttct
cctggccccagccaccccaccttttggacttataccgaggctgcccaccgggctgtactg
tttccccagcagcgactagaccagctgtcagaaatcattgagaggttcatctttgtcatg
cctcctgtggaggcacctcccccttccctgcatgcctgccacccacctccttggctggcc
ccacgtcaggcagccttccaggagcaattggcctctgagctctggccccgggctcgtcct
ttgcaccgtattgtgtgtaacatgcgcacccagttccctgacttaagactcatccagtat
gattgcggaaagttgcagacgttggcagtgctgttgcggcagctcaaggcagagggccac
cgagtgctcatcttcacccagatgacccgaatgctggatgtattggagcagtttctcacc
taccatggccatctctacctgcgcctggatggatctactagagttgaacagagacaggcc
ttgatggaacggttcaatgcagacaaacgcatattctgcttcatcctttcaactcggagt
gggggtgtgggcgtgaacctgacaggagcagacactgttgttttttatgacagcgactgg
aatcccaccatggatgctcaggcccaggaccgctgtcaccgaattggccagacccgggat
gtccacatatataggcttatcagtgaacggacagtggaggagaacatcctaaaaaaggca
aatcagaagagaatgttgggggacatggccattgagggaggcaacttcaccacagcctat
ttcaaacagcagaccatccgagagctgtttgatatgcccctggaggaaccttctagctca
tccgtgccctctgcccctgaagaggaggaagagactgtggccagcaagcagactcatatt
ctggagcaggcattgtgtcgggcagaagatgaagaggatatccgtgcagccacccaggcc
aaggctgaacaggtggctgagcttgcagaatttaatgagaacgatgggtttcctgctggt
gagggagaggaagctggccggcctggggctgaggatgaggagatgtcccgggctgagcag
gaaattgctgccctcgtagaacagctgacccccattgagcgctatgccatgaaattcctg
gaggcctcactggaggaggtgagccgagaggagctcaaacaggcagaagagcaagtggaa
gctgcccgcaaagacctggaccaagccaaggaggaggtgttccgcctaccccaagaggag
gaggaggggccgggggctggggatgagagttcctgtgggactggtggaggcacccaccgg
cgcagtaaaaaggccaaagcccctgagaggccggggactcgtgtcagtgagcgtcttcgt
ggagcccgggctgagactcaaggggcaaaccacactcctgtcatatccgcccatcaaact
cgcagcaccaccacaccaccccgctgcagtcctgccagggagcgagttcccaggccagca
cctaggcctcgacccactccagcttcagctccggctgcaattcctgcccttgttcctgtc
ccagtttctgccccagtacccatttcagccccaaatccaataaccattctccctgtccat
atcttgccttctcctccccctccttcacagattcctccttgttcttctcctgcctgcacc
cctcctcctgcctgtacccctccaccagctcatacaccgcctccagcccaaacctgtctt
gtaactccttcctctcctctcttgcttggtccaccttctgtgcccatctctgcctcagtc
actaatctccccttgggcttgaggcctgaggcagagctgtgtgcccaggcattggcatct
ccagagtccctggagctggcttctgtggccagttcagaaacctcctcactttctcttgtg
ccccctaaagatctgttgccagttgctgtggagatcctgcctgtgtcagagaagaacctt
tctctcaccccttctgcacccagcctgaccttggaggctggcagcatccccaatggtcaa
gagcaggaggcaccagattctgctgaggggaccacccttacagtgctgcctgaaggtgag
gagttgcccctgtgtgtgagtgagagcaatggcctggagctcccaccctcagcagcatct
gatgagccacttcaggagccactggaggctgacaggacctcggaagagctgacagaggcc
aagaccccaacctccagcccagagaagccacaggaactcgttacagctgaggttgcagct
ccatccacctcatcttcagccacttcctcgcctgagggtccttcacctgcccgacctcct
cggcgtcgcaccagtgctgatgtggaaattaggggtcaagggactggtcggccaggacaa
ccaccaggccccaaagtgcttcgaaagctgccaggacggctggtaactgtggtagaggaa
aaggaactggtgcggcggcggcggcagcagcggggagctgccagcaccctagtgcctggg
gtctctgagactagtgccagcccgggaagcccgtctgtccgcagcatgtcagggccagaa
tcctcccctcccattggtgggccctgtgaagctgctccttcatcctcactgcccactcca
ccccagcagcccttcattgctcgccgtcacattgagctgggggtgactggtggtggcagc
cccgagaatggagacggagcactgctcgccatcaccccacctgctgtgaaacgtcggagg
gggaggccccccaagaagaacaggtctccagcagatgctgggagaggtgtggatgaggca
ccctcatccaccttgaagggaaaaaccaatggggctgacccagtccctgggcctgagacc
ctaattgttgcagatcctgtcctggaaccacagcttattcctgggccccagcctcttgga
ccccagccagttcacagacccaatcccctcctgtcacctgtggagaaaagaaggcgagga
cgaccccctaaagcacgagatttgcccatccctgggaccatttcctctgcaggggatggc
aactccgaaagtcggacacagccacccccacacccatcacccctaaccccactcccacca
ctgctagtttgtcccactgctactgttgccaacactgtcaccactgtcaccatttcaacg
tccccacccaaacggaagaggggccgacctcccaagaatcctccatcacctcggcccagc
cagctccccgtcttggaccgtgacagcacttctgttctcgagagctgtggattggggagg
cgacggcaaccccagggccaaggggagagtgagggtagttcctctgatgaggatggaagc
cgccccctcacccgcctggcccgccttcggcttgaagcagaaggaatgcgaggacggaag
agtggagggtccatggtggtggctgtaattcaggatgacctggacttagcagatagcggg
ccaggcgggttggaattgacaccacctgtggtctcactaaccccaaaactgcgctcgacc
cggctgcgtccagggtctctagtccccccactagagactgagaagttgcctcgcaaacga
gcaggggccccagttggtgggagtcctgggctggcaaagcggggccgcctacagccccca
agtcccctggggcctgagggttcagtagaggagtctgaggctgaagcctcaggtgaggag
gaggaaggggatgggaccccacgccgacgtcctggcccccgccggcttgttgggaccacc
aaccaaggggaccagcgcatcctgcgcagcagcgcccctccctccctggctggccctgct
gttagtcacagaggccgcaaggccaagacgtga

DBGET integrated database retrieval system