KEGG   Homo sapiens (human): 10912Help
Entry
10912             CDS       T01001                                 

Gene name
GADD45G, CR6, DDIT2, GADD45gamma, GRP17
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
N00115  Mutation-inactivated TP53 to transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    10912 (GADD45G)
   04068 FoxO signaling pathway
    10912 (GADD45G)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10912 (GADD45G)
   04210 Apoptosis
    10912 (GADD45G)
   04115 p53 signaling pathway
    10912 (GADD45G)
   04218 Cellular senescence
    10912 (GADD45G)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10912 (GADD45G)
   05202 Transcriptional misregulation in cancers
    10912 (GADD45G)
   05210 Colorectal cancer
    10912 (GADD45G)
   05212 Pancreatic cancer
    10912 (GADD45G)
   05225 Hepatocellular carcinoma
    10912 (GADD45G)
   05226 Gastric cancer
    10912 (GADD45G)
   05214 Glioma
    10912 (GADD45G)
   05216 Thyroid cancer
    10912 (GADD45G)
   05220 Chronic myeloid leukemia
    10912 (GADD45G)
   05217 Basal cell carcinoma
    10912 (GADD45G)
   05218 Melanoma
    10912 (GADD45G)
   05213 Endometrial cancer
    10912 (GADD45G)
   05224 Breast cancer
    10912 (GADD45G)
   05222 Small cell lung cancer
    10912 (GADD45G)
   05223 Non-small cell lung cancer
    10912 (GADD45G)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     10912 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     10912 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 10912
NCBI-ProteinID: NP_006696
OMIM: 604949
HGNC: 4097
Ensembl: ENSG00000130222
Vega: OTTHUMG00000020187
Pharos: O95257(Tbio)
UniProt: O95257
Structure
PDB: 

Jmol
Position
9q22.2
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

DBGET integrated database retrieval system