KEGG   Homo sapiens (human): 10987Help
Entry
10987             CDS       T01001                                 

Gene name
COPS5, CSN5, JAB1, MOV-34, SGN5
Definition
(RefSeq) COP9 signalosome subunit 5
  KO
K09613  
COP9 signalosome complex subunit 5 [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     10987 (COPS5)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M67
   10987 (COPS5)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    10987 (COPS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q13.1
AA seq 334 aa AA seqDB search
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccgggagcggtatggcccagaaaacctgggaactggccaacaacatgcag
gaagctcagagtatcgatgaaatctacaaatacgacaagaaacagcagcaagaaatcctg
gcggcgaagccctggactaaggatcaccattactttaagtactgcaaaatctcagcattg
gctctgctgaagatggtgatgcatgccagatcgggaggcaacttggaagtgatgggtctg
atgctaggaaaggtggatggtgaaaccatgatcattatggacagttttgctttgcctgtg
gagggcactgaaacccgagtaaatgctcaggctgctgcatatgaatacatggctgcatac
atagaaaatgcaaaacaggttggccgccttgaaaatgcaatcgggtggtatcatagccac
cctggctatggctgctggctttctgggattgatgttagtactcagatgctcaatcagcag
ttccaggaaccatttgtagcagtggtgattgatccaacaagaacaatatccgcagggaaa
gtgaatcttggcgcctttaggacatacccaaagggctacaaacctcctgatgaaggacct
tctgagtaccagactattccacttaataaaatagaagattttggtgtacactgcaaacaa
tattatgccttagaagtctcatatttcaaatcctctttggatcgcaaattgcttgagctg
ttgtggaataaatactgggtgaatacgttgagttcttctagcttgcttactaatgcagac
tataccactggtcaggtctttgatttgtctgaaaagttagagcagtcagaagcccagctg
ggacgagggagtttcatgttgggtttagaaacgcatgaccgaaaatcagaagacaaactt
gccaaagctacaagagacagctgtaaaactaccatagaagctatccatggattgatgtct
caggttattaaggataaactgtttaatcaaattaacatctcttaa

DBGET integrated database retrieval system