KEGG   Homo sapiens (human): 1107Help
Entry
1107              CDS       T01001                                 

Gene name
CHD3, Mi-2a, Mi2-ALPHA, ZFH
Definition
(RefSeq) chromodomain helicase DNA binding protein 3 (EC:3.6.4.12)
  KO
K11642  
chromodomain-helicase-DNA-binding protein 3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     1107 (CHD3)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    1107 (CHD3)
  Chromatin remodeling factors
   NuRD complex
    1107 (CHD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 2000 aa AA seqDB search
MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKEN
KPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKK
GEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKI
PMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPP
ALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLG
GKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKVL
GCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSC
PHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHI
HCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPR
PLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGED
DGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQ
STWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTV
KYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYK
EGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKG
GKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLN
GYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLL
GPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLN
IMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQGHRVL
IFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGG
LGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKR
KMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAI
ARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEK
LLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEG
RRQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWL
VRDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKK
KVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASATNSPCTSKPATPAP
SEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDE
VPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKG
DRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIW
HRRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLL
EQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAV
LHKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAY
PPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGAL
VSDGLDRKEPRAGEVICIDD
NT seq 6003 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcagacactgtgatcctgtgggcaagaagtaaaaatgaccagctgaggatt
tcttttcctccaggactgtgttggggtgacaggatgcctgataaggatgacattcggctg
ctgccgtcagcattgggtgtgaagaagagaaaacgaggacccaagaagcagaaggagaac
aagccaggaaaaccccgaaaacgcaagaagcgtgacagtgaggaggaatttggttctgag
cgagatgagtaccgggagaagtcagagagtgggggcagtgaatatggaaccggaccgggt
cggaaacgaagaaggaagcaccgagaaaaaaaggagaagaagacaaagcggcggaaaaag
ggggagggagatggggggcaaaagcaagtggaacagaagtcatcagcaactctgcttctg
acctggggcctggaggatgtggagcatgtgttctctgaggaggattaccacacgctcacc
aactacaaagccttcagccagttcatgaggcccctaattgctaagaagaatcctaagatc
ccaatgtctaagatgatgaccatccttggggccaaatggagagagttcagtgccaacaac
cccttcaaggggtcagcagctgctgtggcggcggcagcggcagcagcagcagcagctgta
gctgagcaggtgtcagctgctgtctcgtcggccacccccatagcaccctccggacccccc
gcccttccaccaccccctgctgctgatatccagcccccacccatccgaagagccaaaacc
aaagagggcaaaggtccaggccataagaggcggagtaagagcccccgagtgcctgatgga
cgcaagaagcttcggggaaagaaaatggcaccactcaaaataaaactagggcttctgggt
ggcaagaggaagaaaggaggctcgtatgtttttcagagcgacgaaggtcctgaaccagag
gctgaggaatcagacctggacagtggcagtgtccacagtgcctcaggccggcctgatggc
cctgtccgcaccaagaaactaaagagaggccggccaggaaggaagaagaagaaggtcctg
ggctgtcctgcagtggccggggaggaggaggttgatggctacgagacggatcaccaggat
tactgtgaggtgtgccagcagggtggggaaattattctgtgtgacacctgccctcgtgcc
taccacctcgtctgccttgatcctgagcttgaccgggctccagagggcaaatggagctgc
cctcactgtgagaaggagggggtccagtgggaggccaaggaggaagaagaagaatacgaa
gaggagggagaggaagaaggggagaaggaggaggaggatgatcacatggagtactgccgc
gtatgcaaggacggcggggagctcctgtgctgtgacgcgtgcatctcctcctaccacatt
cattgtctaaaccctcccctgcctgacattcccaatggtgaatggctgtgtccccgatgc
acatgccccgtgctgaagggtcgagtgcagaagatcctacattggcggtggggggagcca
cctgtagcagtgccagcccctcaacaggcagatggaaatccagatgtcccacccccccgt
cctcttcaaggcagatcagagcgagagttctttgtcaagtgggtaggactatcctactgg
cactgctcctgggccaaggagcttcagctggaaatcttccatttggttatgtatcgaaac
taccagcggaagaatgacatggatgagcccccacccctggactatggctccggcgaggat
gatgggaagagcgacaagcgtaaagtgaaagacccgcactatgctgagatggaggagaag
tactatcgttttggcatcaagccagagtggatgaccgtccaccgcatcatcaaccacagt
gtggataaaaaggggaattaccactatctagtaaaatggagggacttaccatatgaccag
tccacgtgggaggaagatgaaatgaatatccctgaatacgaagaacataagcaaagctac
tggagacaccgagaactaattatgggggaagaccctgcccagccccgcaagtataagaag
aagaagaaggagctacagggtgatgggcctcccagttctcccactaatgatcctaccgtg
aaatatgagactcagccacggtttatcacagccactggaggcaccctgcacatgtatcag
ttggaagggctgaactggctacgcttctcctgggcccagggcactgacaccattctagct
gatgagatggggctaggcaagaccatacaaaccatcgtcttcctctactcactctacaag
gagggccacacaaaaggtcccttcctggtgagtgccccactctctaccatcattaactgg
gagcgggagttccagatgtgggcacccaaattctatgtggtgacatacacgggtgacaag
gacagccgggccatcattcgtgagaatgaattctcctttgaggacaatgccatcaaaggg
ggcaagaaagcttttaagatgaagagggaggcacaggtgaagttccatgttctcctgaca
tcgtatgagctgatcaccattgatcaggcagcacttggttccatccgctgggcctgtctt
gtggtagatgaggcccatcgactcaagaacaaccagtccaagtttttcagggttctcaat
ggttacaagatagatcataagttgctgctgacaggaaccccattgcagaataatctggag
gagctcttccatctcctgaacttcctcaccccagagagatttaacaacttggagggcttc
ctggaggagtttgctgacatatccaaagaggaccagatcaagaaactgcatgatttgctg
gggccacacatgctgcggagactcaaggcagatgtctttaagaacatgccagccaagaca
gagctcatcgttcgggtggagctaagccccatgcagaagaaatactacaaatacatcctg
actcgaaattttgaggccttgaattcacgaggtggtgggaaccaggtgtcgctgcttaat
atcatgatggatcttaagaagtgctgcaaccatccatacctttttcccgtggctgctatg
gagtcccccaaactccccagtggggcttatgagggtggggcacttattaagtcgtctggg
aagctcatgctgctccagaagatgctgcgaaagctgaaggagcaaggacaccgagtgctc
atcttctcgcagatgaccaaaatgttagacttgcttgaggacttcttagactatgaaggc
tacaagtatgagcgcatcgatggtggtatcacgggtgccctgaggcaggaggccatcgat
cggtttaatgctcctggggcccaacaattctgcttcctcctgtccacccgagctgggggc
ctgggcatcaatctggccactgctgacactgtcatcatctttgattctgactggaacccc
cataatgacatccaggcctttagccgggctcatcggattggccaggccaacaaagtgatg
atttaccggtttgtgactcgcgcgtcagtggaagagcgaatcacacaagtggccaagaga
aagatgatgctgacacacctggttgtgcggcctgggctgggctccaaggcaggctccatg
tccaagcaggagcttgacgacattctcaaatttggcactgaagagctattcaaggatgaa
aacgagggggagaacaaggaggaggacagcagtgtgattcattatgacaatgaggccatc
gctcggctgttggaccggaaccaggatgcaactgaggacactgacgtgcagaacatgaat
gagtatctcagctccttcaaggtggcacagtacgtcgtgcgggaagaagacaagattgag
gaaattgagcgagagatcatcaagcaggaggagaatgtggaccctgactactgggagaag
ctgctgaggcatcactatgagcaacagcaggaagacctagcccggaatctaggcaagggc
aagcgggttcgcaagcaagttaactacaatgatgctgctcaggaagaccaagacaaccag
tcagagtactcggtgggttcagaggaggaggatgaagacttcgatgaacgtcctgaaggg
cgtagacagtcaaagaggcagctccggaatgagaaagataagccactgcctccactgctg
gcccgagtcgggggcaacattgaggtgctgggcttcaacacccgtcagcggaaggctttc
ctcaatgctgtgatgcgctgggggatgccaccacaggatgccttcaccacacagtggctg
gtgcgggacctgaggggcaagactgagaaggagtttaaggcctatgtgtctttgttcatg
cgccatctgtgtgagcctggggcagacggctctgaaacctttgccgatggggtccctcgg
gagggactgagtcgccagcaggtgttgacccgcattggagtcatgtctctcgtcaaaaag
aaggtgcaggagtttgagcacatcaatgggcgttggtcaatgccggaactgatgcctgac
cccagcgccgattctaagcgctcctccagagcctcctctcctaccaaaacgtctcccacc
actcctgaggcttctgctaccaacagtccctgcacctctaaacctgctactccagctcca
agtgagaaaggagaaggcataaggacacctcttgagaaggaggaagctgaaaaccaggag
gaaaagccagagaagaacagcagaattggggagaagatggagacagaggctgatgccccc
agcccagccccatcacttggggagcggctggagccaaggaagattcctctagaggatgag
gtgccaggggtgcctggagagatggagcctgaacctgggtaccgtggggacagagagaag
tcagccacagagtcgacgccaggagaaaggggggaggagaagccgttggatggacaggaa
cacagggagaggccggagggggaaacaggggatttgggcaagagagaagatgtaaaaggt
gaccgggagcttcgaccagggcctcgagatgagccacggtccaatgggcgacgagaggaa
aagacagagaagccccggttcatgttcaatatcgccgatggtggcttcacagagcttcac
acactgtggcagaatgaggaacgggcagctatttcctcggggaaactcaatgagatctgg
cacagaagacatgactattggcttctggctgggattgtcctccatggctatgcacggtgg
caggacatccagaatgatgctcaatttgccattatcaacgagccatttaaaactgaagcc
aataaggggaactttctggagatgaaaaataagttcctggcccggaggttcaagctcctg
gagcaggcgctggtgattgaggagcagctgcggcgggcggcctacctgaacctgtcgcag
gagccggcgcaccccgccatggccctccacgcccgcttcgccgaggccgagtgcctggcc
gagagccaccagcacctctccaaggagtcgctggcggggaacaagccggccaacgccgtc
ctgcacaaggttctgaaccagctggaggagttgctgagcgacatgaaggcggacgtgacc
cgcctgccagccacgctgtcccgaataccccccatcgcagcccgccttcagatgtccgag
cgcagcatcctcagccggctggccagcaagggcacggagcctcaccccacaccggcctac
ccgccgggtccctacgctacacctccggggtacggggcggccttcagcgccgcacccgta
ggggccctggccgccgcaggcgccaattacagccagatgcctgcagggtccttcatcaca
gccgccaccaacggccctccagtgcttgtgaagaaggagaaggaaatggtgggggcattg
gtgtcagacgggctggatcggaaggagccccgagccggggaggtgatctgtatagacgac
tga

DBGET integrated database retrieval system