KEGG   Homo sapiens (human): 1107Help
Entry
1107              CDS       T01001                                 

Gene name
CHD3, Mi-2a, Mi2-ALPHA, ZFH
Definition
chromodomain helicase DNA binding protein 3 (EC:3.6.4.12)
Orthology
K11642  
chromodomain-helicase-DNA-binding protein 3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     1107 (CHD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 2059 aa AA seqDB search
MASPLRDEEEEEEEMVVSEEEEEEEEEGDEEEEEEVEAADEDDEEDDDEGVLGRGPGHDR
GRDRHSPPGCHLFPPPPPPPPPLPPPPPPPPPDKDDIRLLPSALGVKKRKRGPKKQKENK
PGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKG
EGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIP
MSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPA
LPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLGG
KRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKVLG
CPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCP
HCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHIH
CLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRP
LQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGEDD
GKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQS
TWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTVK
YETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYKE
GHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKGG
KKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNG
YKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLG
PHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNI
MMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQGHRVLI
FSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGGL
GINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRK
MMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAIA
RLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEKL
LRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEGR
RQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWLV
RDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKKK
VQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASATNSPCTSKPATPAPS
EKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEV
PGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKGD
RELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH
RRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLE
QALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAVL
HKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYP
PGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALV
SDGLDRKEPRAGEVICIDD
NT seq 6180 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccctctgagggacgaggaggaggaggaggaggagatggtggtgtcggaggag
gaagaagaggaggaagaagagggcgacgaggaggaggaggaggaggtggaggcggccgac
gaggacgatgaggaggacgacgacgagggagtactcgggcgcgggccgggccacgaccgg
ggccgcgaccgccacagcccccccggctgccacctcttcccgccgccgccgccgccgccg
ccaccgctgcccccgccgccgccgcccccgccgccagataaggatgacattcggctgctg
ccgtcagcattgggtgtgaagaagagaaaacgaggacccaagaagcagaaggagaacaag
ccaggaaaaccccgaaaacgcaagaagcgtgacagtgaggaggaatttggttctgagcga
gatgagtaccgggagaagtcagagagtgggggcagtgaatatggaaccggaccgggtcgg
aaacgaagaaggaagcaccgagaaaaaaaggagaagaagacaaagcggcggaaaaagggg
gagggagatggggggcaaaagcaagtggaacagaagtcatcagcaactctgcttctgacc
tggggcctggaggatgtggagcatgtgttctctgaggaggattaccacacgctcaccaac
tacaaagccttcagccagttcatgaggcccctaattgctaagaagaatcctaagatccca
atgtctaagatgatgaccatccttggggccaaatggagagagttcagtgccaacaacccc
ttcaaggggtcagcagctgctgtggcggcggcagcggcagcagcagcagcagctgtagct
gagcaggtgtcagctgctgtctcgtcggccacccccatagcaccctccggaccccccgcc
cttccaccaccccctgctgctgatatccagcccccacccatccgaagagccaaaaccaaa
gagggcaaaggtccaggccataagaggcggagtaagagcccccgagtgcctgatggacgc
aagaagcttcggggaaagaaaatggcaccactcaaaataaaactagggcttctgggtggc
aagaggaagaaaggaggctcgtatgtttttcagagcgacgaaggtcctgaaccagaggct
gaggaatcagacctggacagtggcagtgtccacagtgcctcaggccggcctgatggccct
gtccgcaccaagaaactaaagagaggccggccaggaaggaagaagaagaaggtcctgggc
tgtcctgcagtggccggggaggaggaggttgatggctacgagacggatcaccaggattac
tgtgaggtgtgccagcagggtggggaaattattctgtgtgacacctgccctcgtgcctac
cacctcgtctgccttgatcctgagcttgaccgggctccagagggcaaatggagctgccct
cactgtgagaaggagggggtccagtgggaggccaaggaggaagaagaagaatacgaagag
gagggagaggaagaaggggagaaggaggaggaggatgatcacatggagtactgccgcgta
tgcaaggacggcggggagctcctgtgctgtgacgcgtgcatctcctcctaccacattcat
tgtctaaaccctcccctgcctgacattcccaatggtgaatggctgtgtccccgatgcaca
tgccccgtgctgaagggtcgagtgcagaagatcctacattggcggtggggggagccacct
gtagcagtgccagcccctcaacaggcagatggaaatccagatgtcccacccccccgtcct
cttcaaggcagatcagagcgagagttctttgtcaagtgggtaggactatcctactggcac
tgctcctgggccaaggagcttcagctggaaatcttccatttggttatgtatcgaaactac
cagcggaagaatgacatggatgagcccccacccctggactatggctccggcgaggatgat
gggaagagcgacaagcgtaaagtgaaagacccgcactatgctgagatggaggagaagtac
tatcgttttggcatcaagccagagtggatgaccgtccaccgcatcatcaaccacagtgtg
gataaaaaggggaattaccactatctagtaaaatggagggacttaccatatgaccagtcc
acgtgggaggaagatgaaatgaatatccctgaatacgaagaacataagcaaagctactgg
agacaccgagaactaattatgggggaagaccctgcccagccccgcaagtataagaagaag
aagaaggagctacagggtgatgggcctcccagttctcccactaatgatcctaccgtgaaa
tatgagactcagccacggtttatcacagccactggaggcaccctgcacatgtatcagttg
gaagggctgaactggctacgcttctcctgggcccagggcactgacaccattctagctgat
gagatggggctaggcaagaccatacaaaccatcgtcttcctctactcactctacaaggag
ggccacacaaaaggtcccttcctggtgagtgccccactctctaccatcattaactgggag
cgggagttccagatgtgggcacccaaattctatgtggtgacatacacgggtgacaaggac
agccgggccatcattcgtgagaatgaattctcctttgaggacaatgccatcaaagggggc
aagaaagcttttaagatgaagagggaggcacaggtgaagttccatgttctcctgacatcg
tatgagctgatcaccattgatcaggcagcacttggttccatccgctgggcctgtcttgtg
gtagatgaggcccatcgactcaagaacaaccagtccaagtttttcagggttctcaatggt
tacaagatagatcataagttgctgctgacaggaaccccattgcagaataatctggaggag
ctcttccatctcctgaacttcctcaccccagagagatttaacaacttggagggcttcctg
gaggagtttgctgacatatccaaagaggaccagatcaagaaactgcatgatttgctgggg
ccacacatgctgcggagactcaaggcagatgtctttaagaacatgccagccaagacagag
ctcatcgttcgggtggagctaagccccatgcagaagaaatactacaaatacatcctgact
cgaaattttgaggccttgaattcacgaggtggtgggaaccaggtgtcgctgcttaatatc
atgatggatcttaagaagtgctgcaaccatccatacctttttcccgtggctgctatggag
tcccccaaactccccagtggggcttatgagggtggggcacttattaagtcgtctgggaag
ctcatgctgctccagaagatgctgcgaaagctgaaggagcaaggacaccgagtgctcatc
ttctcgcagatgaccaaaatgttagacttgcttgaggacttcttagactatgaaggctac
aagtatgagcgcatcgatggtggtatcacgggtgccctgaggcaggaggccatcgatcgg
tttaatgctcctggggcccaacaattctgcttcctcctgtccacccgagctgggggcctg
ggcatcaatctggccactgctgacactgtcatcatctttgattctgactggaacccccat
aatgacatccaggcctttagccgggctcatcggattggccaggccaacaaagtgatgatt
taccggtttgtgactcgcgcgtcagtggaagagcgaatcacacaagtggccaagagaaag
atgatgctgacacacctggttgtgcggcctgggctgggctccaaggcaggctccatgtcc
aagcaggagcttgacgacattctcaaatttggcactgaagagctattcaaggatgaaaac
gagggggagaacaaggaggaggacagcagtgtgattcattatgacaatgaggccatcgct
cggctgttggaccggaaccaggatgcaactgaggacactgacgtgcagaacatgaatgag
tatctcagctccttcaaggtggcacagtacgtcgtgcgggaagaagacaagattgaggaa
attgagcgagagatcatcaagcaggaggagaatgtggaccctgactactgggagaagctg
ctgaggcatcactatgagcaacagcaggaagacctagcccggaatctaggcaagggcaag
cgggttcgcaagcaagttaactacaatgatgctgctcaggaagaccaagacaaccagtca
gagtactcggtgggttcagaggaggaggatgaagacttcgatgaacgtcctgaagggcgt
agacagtcaaagaggcagctccggaatgagaaagataagccactgcctccactgctggcc
cgagtcgggggcaacattgaggtgctgggcttcaacacccgtcagcggaaggctttcctc
aatgctgtgatgcgctgggggatgccaccacaggatgccttcaccacacagtggctggtg
cgggacctgaggggcaagactgagaaggagtttaaggcctatgtgtctttgttcatgcgc
catctgtgtgagcctggggcagacggctctgaaacctttgccgatggggtccctcgggag
ggactgagtcgccagcaggtgttgacccgcattggagtcatgtctctcgtcaaaaagaag
gtgcaggagtttgagcacatcaatgggcgttggtcaatgccggaactgatgcctgacccc
agcgccgattctaagcgctcctccagagcctcctctcctaccaaaacgtctcccaccact
cctgaggcttctgctaccaacagtccctgcacctctaaacctgctactccagctccaagt
gagaaaggagaaggcataaggacacctcttgagaaggaggaagctgaaaaccaggaggaa
aagccagagaagaacagcagaattggggagaagatggagacagaggctgatgcccccagc
ccagccccatcacttggggagcggctggagccaaggaagattcctctagaggatgaggtg
ccaggggtgcctggagagatggagcctgaacctgggtaccgtggggacagagagaagtca
gccacagagtcgacgccaggagaaaggggggaggagaagccgttggatggacaggaacac
agggagaggccggagggggaaacaggggatttgggcaagagagaagatgtaaaaggtgac
cgggagcttcgaccagggcctcgagatgagccacggtccaatgggcgacgagaggaaaag
acagagaagccccggttcatgttcaatatcgccgatggtggcttcacagagcttcacaca
ctgtggcagaatgaggaacgggcagctatttcctcggggaaactcaatgagatctggcac
agaagacatgactattggcttctggctgggattgtcctccatggctatgcacggtggcag
gacatccagaatgatgctcaatttgccattatcaacgagccatttaaaactgaagccaat
aaggggaactttctggagatgaaaaataagttcctggcccggaggttcaagctcctggag
caggcgctggtgattgaggagcagctgcggcgggcggcctacctgaacctgtcgcaggag
ccggcgcaccccgccatggccctccacgcccgcttcgccgaggccgagtgcctggccgag
agccaccagcacctctccaaggagtcgctggcggggaacaagccggccaacgccgtcctg
cacaaggttctgaaccagctggaggagttgctgagcgacatgaaggcggacgtgacccgc
ctgccagccacgctgtcccgaataccccccatcgcagcccgccttcagatgtccgagcgc
agcatcctcagccggctggccagcaagggcacggagcctcaccccacaccggcctacccg
ccgggtccctacgctacacctccggggtacggggcggccttcagcgccgcacccgtaggg
gccctggccgccgcaggcgccaattacagccagatgcctgcagggtccttcatcacagcc
gccaccaacggccctccagtgcttgtgaagaaggagaaggaaatggtgggggcattggtg
tcagacgggctggatcggaaggagccccgagccggggaggtgatctgtatagacgactga

DBGET integrated database retrieval system