KEGG   Homo sapiens (human): 1107Help
Entry
1107              CDS       T01001                                 

Gene name
CHD3, Mi-2a, Mi2-ALPHA, ZFH
Definition
chromodomain helicase DNA binding protein 3 (EC:3.6.4.12)
Orthology
K11642  
chromodomain-helicase-DNA-binding protein 3 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 2059 aa AA seqDB search
MASPLRDEEEEEEEMVVSEEEEEEEEEGDEEEEEEVEAADEDDEEDDDEGVLGRGPGHDR
GRDRHSPPGCHLFPPPPPPPPPLPPPPPPPPPDKDDIRLLPSALGVKKRKRGPKKQKENK
PGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKG
EGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIP
MSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPA
LPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLGG
KRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKVLG
CPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCP
HCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHIH
CLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRP
LQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGEDD
GKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQS
TWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTVK
YETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYKE
GHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKGG
KKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNG
YKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLG
PHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNI
MMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQGHRVLI
FSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGGL
GINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRK
MMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAIA
RLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEKL
LRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEGR
RQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWLV
RDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKKK
VQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASATNSPCTSKPATPAPS
EKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEV
PGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKGD
RELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH
RRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLE
QALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAVL
HKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYP
PGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALV
SDGLDRKEPRAGEVICIDD
NT seq 6180 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccctctgagggacgaggaggaggaggaggaggagatggtggtgtcggaggag
gaagaagaggaggaagaagagggcgacgaggaggaggaggaggaggtggaggcggccgac
gaggacgatgaggaggacgacgacgagggagtactcgggcgcgggccgggccacgaccgg
ggccgcgaccgccacagcccccccggctgccacctcttcccgccgccgccgccgccgccg
ccaccgctgcccccgccgccgccgcccccgccgccagataaggatgacattcggctgctg
ccgtcagcattgggtgtgaagaagagaaaacgaggacccaagaagcagaaggagaacaag
ccaggaaaaccccgaaaacgcaagaagcgtgacagtgaggaggaatttggttctgagcga
gatgagtaccgggagaagtcagagagtgggggcagtgaatatggaaccggaccgggtcgg
aaacgaagaaggaagcaccgagaaaaaaaggagaagaagacaaagcggcggaaaaagggg
gagggagatggggggcaaaagcaagtggaacagaagtcatcagcaactctgcttctgacc
tggggcctggaggatgtggagcatgtgttctctgaggaggattaccacacgctcaccaac
tacaaagccttcagccagttcatgaggcccctaattgctaagaagaatcctaagatccca
atgtctaagatgatgaccatccttggggccaaatggagagagttcagtgccaacaacccc
ttcaaggggtcagcagctgctgtggcggcggcagcggcagcagcagcagcagctgtagct
gagcaggtgtcagctgctgtctcgtcggccacccccatagcaccctccggaccccccgcc
cttccaccaccccctgctgctgatatccagcccccacccatccgaagagccaaaaccaaa
gagggcaaaggtccaggccataagaggcggagtaagagcccccgagtgcctgatggacgc
aagaagcttcggggaaagaaaatggcaccactcaaaataaaactagggcttctgggtggc
aagaggaagaaaggaggctcgtatgtttttcagagcgacgaaggtcctgaaccagaggct
gaggaatcagacctggacagtggcagtgtccacagtgcctcaggccggcctgatggccct
gtccgcaccaagaaactaaagagaggccggccaggaaggaagaagaagaaggtcctgggc
tgtcctgcagtggccggggaggaggaggttgatggctacgagacggatcaccaggattac
tgtgaggtgtgccagcagggtggggaaattattctgtgtgacacctgccctcgtgcctac
cacctcgtctgccttgatcctgagcttgaccgggctccagagggcaaatggagctgccct
cactgtgagaaggagggggtccagtgggaggccaaggaggaagaagaagaatacgaagag
gagggagaggaagaaggggagaaggaggaggaggatgatcacatggagtactgccgcgta
tgcaaggacggcggggagctcctgtgctgtgacgcgtgcatctcctcctaccacattcat
tgtctaaaccctcccctgcctgacattcccaatggtgaatggctgtgtccccgatgcaca
tgccccgtgctgaagggtcgagtgcagaagatcctacattggcggtggggggagccacct
gtagcagtgccagcccctcaacaggcagatggaaatccagatgtcccacccccccgtcct
cttcaaggcagatcagagcgagagttctttgtcaagtgggtaggactatcctactggcac
tgctcctgggccaaggagcttcagctggaaatcttccatttggttatgtatcgaaactac
cagcggaagaatgacatggatgagcccccacccctggactatggctccggcgaggatgat
gggaagagcgacaagcgtaaagtgaaagacccgcactatgctgagatggaggagaagtac
tatcgttttggcatcaagccagagtggatgaccgtccaccgcatcatcaaccacagtgtg
gataaaaaggggaattaccactatctagtaaaatggagggacttaccatatgaccagtcc
acgtgggaggaagatgaaatgaatatccctgaatacgaagaacataagcaaagctactgg
agacaccgagaactaattatgggggaagaccctgcccagccccgcaagtataagaagaag
aagaaggagctacagggtgatgggcctcccagttctcccactaatgatcctaccgtgaaa
tatgagactcagccacggtttatcacagccactggaggcaccctgcacatgtatcagttg
gaagggctgaactggctacgcttctcctgggcccagggcactgacaccattctagctgat
gagatggggctaggcaagaccatacaaaccatcgtcttcctctactcactctacaaggag
ggccacacaaaaggtcccttcctggtgagtgccccactctctaccatcattaactgggag
cgggagttccagatgtgggcacccaaattctatgtggtgacatacacgggtgacaaggac
agccgggccatcattcgtgagaatgaattctcctttgaggacaatgccatcaaagggggc
aagaaagcttttaagatgaagagggaggcacaggtgaagttccatgttctcctgacatcg
tatgagctgatcaccattgatcaggcagcacttggttccatccgctgggcctgtcttgtg
gtagatgaggcccatcgactcaagaacaaccagtccaagtttttcagggttctcaatggt
tacaagatagatcataagttgctgctgacaggaaccccattgcagaataatctggaggag
ctcttccatctcctgaacttcctcaccccagagagatttaacaacttggagggcttcctg
gaggagtttgctgacatatccaaagaggaccagatcaagaaactgcatgatttgctgggg
ccacacatgctgcggagactcaaggcagatgtctttaagaacatgccagccaagacagag
ctcatcgttcgggtggagctaagccccatgcagaagaaatactacaaatacatcctgact
cgaaattttgaggccttgaattcacgaggtggtgggaaccaggtgtcgctgcttaatatc
atgatggatcttaagaagtgctgcaaccatccatacctttttcccgtggctgctatggag
tcccccaaactccccagtggggcttatgagggtggggcacttattaagtcgtctgggaag
ctcatgctgctccagaagatgctgcgaaagctgaaggagcaaggacaccgagtgctcatc
ttctcgcagatgaccaaaatgttagacttgcttgaggacttcttagactatgaaggctac
aagtatgagcgcatcgatggtggtatcacgggtgccctgaggcaggaggccatcgatcgg
tttaatgctcctggggcccaacaattctgcttcctcctgtccacccgagctgggggcctg
ggcatcaatctggccactgctgacactgtcatcatctttgattctgactggaacccccat
aatgacatccaggcctttagccgggctcatcggattggccaggccaacaaagtgatgatt
taccggtttgtgactcgcgcgtcagtggaagagcgaatcacacaagtggccaagagaaag
atgatgctgacacacctggttgtgcggcctgggctgggctccaaggcaggctccatgtcc
aagcaggagcttgacgacattctcaaatttggcactgaagagctattcaaggatgaaaac
gagggggagaacaaggaggaggacagcagtgtgattcattatgacaatgaggccatcgct
cggctgttggaccggaaccaggatgcaactgaggacactgacgtgcagaacatgaatgag
tatctcagctccttcaaggtggcacagtacgtcgtgcgggaagaagacaagattgaggaa
attgagcgagagatcatcaagcaggaggagaatgtggaccctgactactgggagaagctg
ctgaggcatcactatgagcaacagcaggaagacctagcccggaatctaggcaagggcaag
cgggttcgcaagcaagttaactacaatgatgctgctcaggaagaccaagacaaccagtca
gagtactcggtgggttcagaggaggaggatgaagacttcgatgaacgtcctgaagggcgt
agacagtcaaagaggcagctccggaatgagaaagataagccactgcctccactgctggcc
cgagtcgggggcaacattgaggtgctgggcttcaacacccgtcagcggaaggctttcctc
aatgctgtgatgcgctgggggatgccaccacaggatgccttcaccacacagtggctggtg
cgggacctgaggggcaagactgagaaggagtttaaggcctatgtgtctttgttcatgcgc
catctgtgtgagcctggggcagacggctctgaaacctttgccgatggggtccctcgggag
ggactgagtcgccagcaggtgttgacccgcattggagtcatgtctctcgtcaaaaagaag
gtgcaggagtttgagcacatcaatgggcgttggtcaatgccggaactgatgcctgacccc
agcgccgattctaagcgctcctccagagcctcctctcctaccaaaacgtctcccaccact
cctgaggcttctgctaccaacagtccctgcacctctaaacctgctactccagctccaagt
gagaaaggagaaggcataaggacacctcttgagaaggaggaagctgaaaaccaggaggaa
aagccagagaagaacagcagaattggggagaagatggagacagaggctgatgcccccagc
ccagccccatcacttggggagcggctggagccaaggaagattcctctagaggatgaggtg
ccaggggtgcctggagagatggagcctgaacctgggtaccgtggggacagagagaagtca
gccacagagtcgacgccaggagaaaggggggaggagaagccgttggatggacaggaacac
agggagaggccggagggggaaacaggggatttgggcaagagagaagatgtaaaaggtgac
cgggagcttcgaccagggcctcgagatgagccacggtccaatgggcgacgagaggaaaag
acagagaagccccggttcatgttcaatatcgccgatggtggcttcacagagcttcacaca
ctgtggcagaatgaggaacgggcagctatttcctcggggaaactcaatgagatctggcac
agaagacatgactattggcttctggctgggattgtcctccatggctatgcacggtggcag
gacatccagaatgatgctcaatttgccattatcaacgagccatttaaaactgaagccaat
aaggggaactttctggagatgaaaaataagttcctggcccggaggttcaagctcctggag
caggcgctggtgattgaggagcagctgcggcgggcggcctacctgaacctgtcgcaggag
ccggcgcaccccgccatggccctccacgcccgcttcgccgaggccgagtgcctggccgag
agccaccagcacctctccaaggagtcgctggcggggaacaagccggccaacgccgtcctg
cacaaggttctgaaccagctggaggagttgctgagcgacatgaaggcggacgtgacccgc
ctgccagccacgctgtcccgaataccccccatcgcagcccgccttcagatgtccgagcgc
agcatcctcagccggctggccagcaagggcacggagcctcaccccacaccggcctacccg
ccgggtccctacgctacacctccggggtacggggcggccttcagcgccgcacccgtaggg
gccctggccgccgcaggcgccaattacagccagatgcctgcagggtccttcatcacagcc
gccaccaacggccctccagtgcttgtgaagaaggagaaggaaatggtgggggcattggtg
tcagacgggctggatcggaaggagccccgagccggggaggtgatctgtatagacgactga

DBGET integrated database retrieval system