KEGG   Homo sapiens (human): 11078Help
Entry
11078             CDS       T01001                                 

Gene name
TRIOBP, DFNB28, TAP68, TARA, dJ37E16.4
Definition
TRIO and F-actin binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00605  
Deafness, autosomal recessive
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 2365 aa AA seqDB search
MEEVPGDALCEHFEANILTQNRCQNCFHPEEAHGARYQELRSPSGAEVPYCDLPRCPPAP
EDPLSASTSGCQSVVDPGLRPGPKRGPSPSAGLPEEGPTAAPRSRSRELEAVPYLEGLTT
SLCGSCNEDPGSDPTSSPDSATPDDTSNSSSVDWDTVERQEEEAPSWDELAVMIPRRPRE
GPRADSSQRAPSLLTRSPVGGDAAGQKKEDTGGGGRSAGQHWARLRGESGLSLERHRSTL
TQASSMTPHSGPRSTTSQASPAQRDTAQAASTREIPRASSPHRITQRDTSRASSTQQEIS
RASSTQQETSRASSTQEDTPRASSTQEDTPRASSTQWNTPRASSPSRSTQLDNPRTSSTQ
QDNPQTSFPTCTPQRENPRTPCVQQDDPRASSPNRTTQRENSRTSCAQRDNPKASRTSSP
NRATRDNPRTSCAQRDNPRASSPSRATRDNPTTSCAQRDNPRASRTSSPNRATRDNPRTS
CAQRDNPRASSPSRATRDNPTTSCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASS
PNRAARDNPTTSCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPNRATRDNPTT
SCAQRDNPRASRTSSPNRATRDNPRTSCAQRDNPRASSPNRTTQQDSPRTSCARRDDPRA
SSPNRTIQQENPRTSCALRDNPRASSPSRTIQQENPRTSCAQRDDPRASSPNRTTQQENP
RTSCARRDNPRASSRNRTIQRDNPRTSCAQRDNPRASSPNRTIQQENLRTSCTRQDNPRT
SSPNRATRDNPRTSCAQRDNLRASSPIRATQQDNPRTCIQQNIPRSSSTQQDNPKTSCTK
RDNLRPTCTQRDRTQSFSFQRDNPGTSSSQCCTQKENLRPSSPHRSTQWNNPRNSSPHRT
NKDIPWASFPLRPTQSDGPRTSSPSRSKQSEVPWASIALRPTQGDRPQTSSPSRPAQHDP
PQSSFGPTQYNLPSRATSSSHNPGHQSTSRTSSPVYPAAYGAPLTSPEPSQPPCAVCIGH
RDAPRASSPPRYLQHDPFPFFPEPRAPESEPPHHEPPYIPPAVCIGHRDAPRASSPPRHT
QFDPFPFLPDTSDAEHQCQSPQHEPLQLPAPVCIGYRDAPRASSPPRQAPEPSLLFQDLP
RASTESLVPSMDSLHECPHIPTPVCIGHRDAPSFSSPPRQAPEPSLFFQDPPGTSMESLA
PSTDSLHGSPVLIPQVCIGHRDAPRASSPPRHPPSDLAFLAPSPSPGSSGGSRGSAPPGE
TRHNLEREEYTVLADLPPPRRLAQRQPGPQAQCSSGGRTHSPGRAEVERLFGQERRKSEA
AGAFQAQDEGRSQQPSQGQSQLLRRQSSPAPSRQVTMLPAKQAELTRRSQAEPPHPWSPE
KRPEGDRQLQGSPLPPRTSARTPERELRTQRPLESGQAGPRQPLGVWQSQEEPPGSQGPH
RHLERSWSSQEGGLGPGGWWGCGEPSLGAAKAPEGAWGGTSREYKESWGQPEAWEEKPTH
ELPRELGKRSPLTSPPENWGGPAESSQSWHSGTPTAVGWGAEGACPYPRGSERRPELDWR
DLLGLLRAPGEGVWARVPSLDWEGLLELLQARLPRKDPAGHRDDLARALGPELGPPGTND
VPEQESHSQPEGWAEATPVNGHSPALQSQSPVQLPSPACTSTQWPKIKVTRGPATATLAG
LEQTGPLGSRSTAKGPSLPELQFQPEEPEESEPSRGQDPLTDQKQADSADKRPAEGKAGS
PLKGRLVTSWRMPGDRPTLFNPFLLSLGVLRWRRPDLLNFKKGWMSILDEPGEPPSPSLT
TTSTSQWKKHWFVLTDSSLKYYRDSTAEEADELDGEIDLRSCTDVTEYAVQRNYGFQIHT
KDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTKLSDSNKENALHSYSTQKGPLKAGE
QRAGSEVISRGGPRKADGQRQALDYVELSPLTQASPQRARTPARTPDRLAKQEELERDLA
QRSEERRKWFEATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRE
NKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSALRSQEDGH
IPPGYISQEACERSLAEMESSHQQVMEELQRHHERELQRLQQEKEWLLAEETAATASAIE
AMKKAYQEELSRELSKTRSLQQGPDGLRKQHQSDVEALKRELQVLSEQYSQKCLEIGALM
RQAEEREHTLRRCQQEGQELLRHNQELHGRLSEEIDQLRGFIASQGMGNGCGRSNERSSC
ELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKYQDVYVELSHIKTRSEREIE
QLKEHLRLAMAALQEKESMRNSLAE
NT seq 7098 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtgcctggggatgccctgtgtgaacactttgaggccaacatacttacccag
aaccgctgtcaaaactgcttccaccctgaggaggcccatggagcaagataccaggagctc
aggagcccttcaggtgctgaggtgccctactgcgacctgcctcgatgtccacctgcccct
gaggacccactcagcgcctcaacctccggctgccagtctgtggtggacccaggcctcagg
ccagggcccaagaggggcccatccccctcagcagggctcccagaagagggtcccacagct
gcccccaggagcaggagccgggagcttgaggcagtaccctatctggagggcctgaccact
tccttgtgtggcagctgcaacgaggaccccggctctgaccccacctccagccctgactcc
gccacccctgatgataccagcaactcgtcctctgtggactgggacactgttgagaggcag
gaggaggaggcccccagctgggacgagctcgcagtgatgatcccgaggaggcctcgggag
gggccgagagctgacagctcccaaagggctccgtctctcctcaccaggtcccctgtggga
ggagatgctgcaggccagaaaaaggaggacaccggcggtgggggccggagcgcaggacag
cactgggcaaggctccggggagaaagcgggttgtccctggagcggcaccggtcaacactg
acccaggcttcctccatgacaccacacagtggacctcgaagcaccacgtctcaggcttct
cctgcccaaagggacactgctcaggctgcctctacacgtgaaatccccagagcctcctct
ccccatcgaatcacccaaagggacacctccagggcctcatccacccaacaggaaatctcc
agggcctcatccacccaacaggaaacctccagggcctcatccacccaagaggacacccct
agggcctcatccacccaagaggacacccccagggcctcatctacacagtggaacaccccc
agagcttcctctccctcacgaagcacccaactggataaccccagaacctcttctacccag
caggacaacccccaaacttcttttcctacttgtactccccagcgggaaaaccccaggaca
ccctgtgtccagcaggacgatcccagagcctcctctcccaacagaaccactcaacgagag
aattccagaacatcctgtgcccagcgggacaatcccaaagcctccagaacctcctctccc
aatagagccacacgagacaaccccagaacatcctgcgcccagcgggacaatcccagagcc
tcctctcccagtagagctacacgagacaaccccacaacatcctgtgcccagcgggacaat
cccagagcctccagaacctcctctcccaatagagccacacgagacaaccccagaacatcc
tgtgcccagcgggacaatcccagagcctcctctcccagtagagctacacgagacaacccc
acaacatcctgtgcccagcgggacaatcccagagcctccagaacctcctctcccaataga
gccacacgagacaaccccagaacatcctgcgcccagcgggacaatcccagagcctcctct
cccaatagagctgcacgagacaaccccacaacatcctgtgcccagcgggacaatcccaga
gcctccagaacctcctctcccaatagagccacacgagacaaccccagaacatcctgtgcc
cagcgggacaatcccagagcctcctctcccaatagagctacacgagacaaccccacaaca
tcctgtgcccagcgggacaatcccagagcctccagaacctcctctcccaatagagccaca
cgagataaccccagaacatcctgtgcccagcgggacaatcccagagcctcctctcccaac
agaaccacccaacaagacagccccagaacatcctgtgcccgacgggacgatcccagagcc
tcctctcctaacagaaccatccaacaagagaaccccagaacatcctgtgccctacgggac
aatcccagagcctcctctcccagcagaaccatccaacaagagaaccccagaacatcctgt
gcccaacgggacgatcccagagcctcctctcctaacagaaccacccaacaagagaacccc
agaacatcctgtgcccgacgggacaatcccagagcctcctctcgcaacagaaccatccag
cgagacaaccccagaacatcctgtgcccagcgggacaatcccagagcctcctctcctaac
agaaccatccaacaagagaacctcagaacatcctgtacccgacaggacaatcccaggacc
tcctctcccaatagagccacacgagacaaccccagaacatcctgtgcccagcgggacaat
ctcagagcctcctctcccatcagagccacccaacaggacaaccccagaacttgtattcaa
cagaacatccccagatcatcttctacccaacaagacaaccctaaaacctcttgtaccaaa
cgagataacctcagacccacttgtacacagcgggaccgcacacagtccttttcctttcaa
cgagacaaccctggaacctcctcatctcaatgctgcacccaaaaggagaatctgagacca
tcatctccccaccgctccactcaatggaacaatcccaggaattcatctccccatcgtact
aacaaagacatcccctgggcctcgtttcccctccggccaactcagagtgatggtccccga
acctcttccccatctcgctccaagcaaagcgaggttccctgggcatccatcgccctccgg
ccaacccaaggtgacaggcctcagacatcctctcccagcaggccagcccagcatgaccca
ccccagtcctcctttggccccacccagtacaacttgccatcccgggccacctcttcctcc
cataacccaggccaccagagcacctcccgaacttcctcacctgtgtaccccgctgcctat
ggggctcccctgacctctcctgagccctcccagcctccatgtgctgtgtgcattgggcac
cgggatgcccctcgagcctcttcgccccctcgctatttgcagcacgaccccttccccttc
ttcccagagccccgcgcccctgagagtgaaccgccccaccacgagcctccctatatacca
cctgctgtgtgcattggacaccgagatgccccccgggcgtcctcgcccccccgccacacc
caatttgaccccttccccttcctcccagacacatcagatgccgagcatcagtgtcagtcc
ccccaacacgagccccttcagctccctgcacctgtgtgtattgggtaccgagatgcaccc
cgggcctcctccccaccacgccaggccccagagccttccctcttattccaggacctcccc
agggccagcacagagagccttgtcccttccatggactctctgcacgagtgcccccacatc
cccacccctgtgtgcattgggcaccgggatgcaccctccttctcatccccaccacgccag
gctcctgagccatccctcttcttccaggatccccctggaactagtatggagagcctggcc
ccctccactgactctctgcatggctccccagtgctgatcccccaagtgtgcatcgggcac
cgggatgcaccccgagcctcctccccaccccgccacccacccagtgacctagcgttcctg
gcaccctcaccttcaccgggcagctctgggggctcccggggctcagcgcctcccggggag
accaggcacaacttggagcgggaggagtacactgtgctggccgacctgcccccacccagg
aggctggcccagagacagccagggccccaggcgcagtgcagcagcgggggccgcacccac
agccctggccgtgcagaggtggagcgcctcttcgggcaagagcgcaggaagtccgaggca
gcgggggccttccaggcccaggacgagggacggtcacagcagcccagccaaggccagagc
caacttctccgaagacagtccagccctgcccccagcaggcaggtgaccatgctccctgcc
aaacaggcagaactgacccggcggagccaagcagagccccctcatccttggagtcctgag
aagagacctgagggagatcggcagctccaggggtccccgctgccccccaggacatcagcc
aggacccctgagagggagctgcggacacagagacctctggagagtggccaagcaggccca
agacagcctctgggggtgtggcagagtcaggaggaaccgccagggtcccagggccctcat
agacacctagaaaggagctggagcagccaggagggaggcctgggccctgggggctggtgg
ggatgtggagagcccagcctgggggcagccaaagccccggagggagcatgggggggcact
tccagggagtacaaggagagctgggggcagccagaggcctgggaggagaagcccactcat
gagctccccagagaactaggaaagagaagcccactcacgagcccccctgagaactgggga
ggccccgcagagtcctcacaatcctggcactctgggacacccactgctgtgggctggggg
gcagagggagcgtgtccatacccgcgtggctctgagaggcgacccgagcttgactggagg
gatctgcttggccttctccgggcaccaggagagggggtctgggcccgtgtccccagcctg
gactgggagggcctcttggagctcctgcaggccaggctgccccgcaaggacccagctgga
cacagggatgacctggccagggctttagggccagagctgggtcccccaggcacaaacgat
gtccctgagcaggagtcacacagccagccagaaggctgggccgaggccaccccagtcaat
ggacacagccccgcactgcagtcccagagcccggtccagctgcccagccctgcctgcacc
tccacccagtggccaaagatcaaagtgacaagaggaccagcgaccgcaactctggcaggc
ctggagcagacgggccccctggggagcaggagcactgcgaagggccccagcttgccagag
ctgcagttccaaccagaggagcctgaggagtcagaaccaagcagaggccaagaccccctg
actgaccagaagcaggcagactcggcagacaagaggccagcagagggcaaggctgggagc
ccgctcaagggccgactggtgacctcatggcggatgcccggggaccggcccacgctgttc
aatccgttcctgctgtctctgggggtcctcaggtggcgaaggcccgatctgctcaacttc
aagaagggatggatgtcgatcttggacgagcctggagagcctccctccccctcgctcacc
accacctctacttcgcagtggaagaaacattggtttgtgctgacagattcaagtctcaaa
tattacagagactccactgctgaggaggcagatgagctggatggtgagatcgacctgcgt
tcctgcacggatgtcactgagtacgcggtgcagcgcaactatggcttccagatccacacc
aaggatgctgtctataccttgtcggccatgacctcaggcatccggcggaactggatcgag
gctctgagaaagaccgtacgtccaacttcagccccagatgtcaccaagctctcggactct
aacaaggagaacgcgctgcacagctacagcacccagaagggccccctgaaggcaggggag
cagcgggcgggctctgaggtcatcagccggggtggccctcggaaggcggacgggcagcgt
caggccttggactacgtggagctctcgccgctgacccaggcttccccgcagcgggcccgc
accccagcccgcactcctgaccgcctggccaagcaggaggagctggagcgggacctggcc
cagcgctccgaggagcggcgcaagtggtttgaggccacagacagcaggaccccagaggtg
cctgctggtgaggggccgcgccggggcctgggtgcccccctgactgaggaccagcaaaac
cggcttagtgaggagatcgagaagaagtggcaggagctggagaagctgcccctgcgggag
aataagcgggtgcccctcactgccctgctcaaccaaagccgcggagagcgccgagggccc
ccaagtgacggccacgaggcactggagaaggaggttcaggctcttcgggcccagctggag
gcgtggcgtctccaaggggaggctcctcagagtgcactgagatcccaggaggatggccac
atccccccgggctacatctcacaggaggcatgtgagcgcagcctggcagagatggagtcc
tcgcaccagcaggtgatggaggagctgcagcggcaccacgagcgggagctgcagcgcctg
cagcaggagaaggagtggctcctggctgaggagacggcagccacggcctcagccattgaa
gccatgaagaaggcctaccaggaagagctgagccgagagctgagcaaaacacggagtctc
cagcagggcccggatggcctccggaagcagcaccagtcagatgtggaggcactgaagcga
gagctgcaggtgctatcggagcagtactcgcagaagtgcctggagattggggcactcatg
cggcaggctgaggagcgcgagcacacgctgcgccgctgccagcaggagggccaggagctg
ctgcgccacaaccaggagctgcatggccgcctgtcagaggagatagaccagctgcgcggc
ttcattgcctcgcagggcatgggcaatggctgcgggcgcagcaacgagcggagttcctgc
gagctagaggtgctgcttcgcgtaaaagaaaacgaactccagtacctaaagaaggaggtg
cagtgcctccgggacgagctccagatgatgcagaaggacaagcgcttcacctcgggaaag
taccaggacgtctatgtggagctgagccacatcaagacacggtctgagcgggagatcgag
cagctgaaggagcacctgcgtcttgccatggccgccctccaggagaaggagtcgatgcgc
aacagcctggctgagtag

DBGET integrated database retrieval system