KEGG   Homo sapiens (human): 11186Help
Entry
11186             CDS       T01001                                 

Gene name
RASSF1, 123F2, NORE2A, RASSF1A, RDA32, REH3P21
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  
Ras association domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Hippo signaling pathway
Hippo signaling pathway -multiple species
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Non-small cell lung cancer
Disease
H00014  
Non-small cell lung cancer
H00022  
Bladder cancer
H00054  
Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    11186 (RASSF1)
   04390 Hippo signaling pathway
    11186 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    11186 (RASSF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11186 (RASSF1)
   05206 MicroRNAs in cancer
    11186 (RASSF1)
   05219 Bladder cancer
    11186 (RASSF1)
   05223 Non-small cell lung cancer
    11186 (RASSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 344 aa AA seqDB search
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggagcctgagctcattgagctgcgggagctggcacccgctgggcgcgctggg
aagggccgcacccggctggagcgtgccaacgcgctgcgcatcgcgcggggcaccgcgtgc
aaccccacacggcagctggtccctggccgtggccaccgcttccagcccgcggggcccgcc
acgcacacgtggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaaaggcctg
cagtgcgcgcgcctctctgcagattgcaagttcacctgccactaccgctgccgcgcgctc
gtctgcctggactgttgcgggccccgggacctgggctgggaacccgcggtggagcgggac
acgaacgtggacgagcctgtggagtgggagacacctgacctttctcaagctgagattgag
cagaagatcaaggagtacaatgcccagatcaacagcaacctcttcatgagcttgaacaag
gacggttcttacacaggcttcatcaaggttcagctgaagctggtgcgccctgtctctgtg
ccctccagcaagaagccaccctccttgcaggatgcccggcggggcccaggacggggcaca
agtgtcaggcgccgcacttccttttacctgcccaaggatgctgtcaagcacctgcatgtg
ctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcgaaagttcttggtggtg
gatgacccccgcaagtttgcactctttgagcgcgctgagcgtcacggccaagtgtacttg
cggaagctgttggatgatgagcagcccctgcggctgcggctcctggcagggcccagtgac
aaggccctgagctttgtcctgaaggaaaatgactctggggaggtgaactgggacgccttc
agcatgcctgaactacataacttcctacgtatcctgcagcgggaggaggaggagcacctc
cgccagatcctgcagaagtactcctattgccgccagaagatccaagaggccctgcacgcc
tgcccccttgggtga

DBGET integrated database retrieval system