KEGG   Homo sapiens (human): 11213Help
Entry
11213             CDS       T01001                                 

Gene name
IRAK3, ASRT5, IRAKM
Definition
interleukin-1 receptor-associated kinase 3 (EC:2.7.11.1)
Orthology
K04732  
interleukin-1 receptor-associated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    11213 (IRAK3)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    11213 (IRAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11213 (IRAK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  IRAK family
   11213 (IRAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q14.3
AA seq 535 aa AA seqDB search
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLGAVLSPSEKSYQEGGF
PNILFKETANVTVDNVLIPEHNEKGILLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYR
VEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLIY
PYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSISSANILL
DDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSFG
IVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFCL
AGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVED
DESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEE
SWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaactgtggggcccgcggcgcgctgtcggcgcacacgctgctgttcgacctg
ccgcccgcgctgctcggagagctctgcgctgttctggacagctgcgacggcgcgctgggc
tggcgcggcctgggagcagtgttgagtccttcagagaagagttatcaggaaggtggattt
ccaaatatattattcaaggaaacagccaatgtcaccgtggataatgttcttattcctgaa
cataatgaaaaaggaatactgcttaaatcttccatcagctttcaaaatatcatagaagga
actagaaatttccacaaagacttcctaattggagaaggagagatttttgaggtatacaga
gtggagattcaaaacctaacatatgctgtcaaattatttaaacaggagaaaaaaatgcag
tgtaagaagcattggaagaggtttttatctgagcttgaagttttactactgtttcatcac
ccaaacatactagagttggctgcatattttacagagactgagaagttctgtctgatttat
ccatacatgagaaatggaacactttttgacagattgcagtgtgtaggtgacacggcccca
ctcccttggcacattcgaatcggtatattaataggaatatccaaagccattcactacctg
cacaacgttcaaccatgctcggtcatctgtggcagtatatcaagtgcaaacatccttttg
gatgatcagtttcaacccaaactaactgattttgccatggcacacttccggtcccaccta
gaacatcagagttgtaccataaatatgaccagcagcagcagtaaacatctgtggtacatg
ccagaagagtacatcagacaggggaaactttccattaaaacagatgtctacagctttgga
attgtaataatggaagttctaacaggatgtagagtagtgttagatgatccaaaacatatc
cagctgcgggatctccttagagaattgatggagaagagaggcctggattcatgtctctca
tttctagataagaaagtgcctccctgccctcggaatttctctgccaagctcttctgtttg
gcaggccggtgtgctgcaacgcgggcaaagttaagaccatcaatggatgaagttttaaat
actcttgaaagtactcaagccagcttgtattttgctgaagatcctcccacatcactaaag
tccttcaggtgtccttctcctctattcctggagaatgtaccaagtattccagtggaagat
gatgaaagccagaataacaatttactaccttctgatgaaggcctgaggatagacagaatg
actcagaaaactccttttgaatgcagccagtctgaggttatgtttctgagcttggacaaa
aagccagagagcaagagaaatgaggaagcttgcaacatgcccagttcttcttgtgaagaa
agttggttcccaaagtatatagttccatcccaggacttaaggccctataaggtaaatata
gatccttcttcagaagctccagggcattcttgcaggagcaggccagtggagagcagctgt
tcctccaaattttcctgggatgaatatgaacagtacaaaaaagaataa

DBGET integrated database retrieval system