KEGG   Homo sapiens (human): 1130Help
Entry
1130              CDS       T01001                                 

Gene name
LYST, CHS, CHS1
Definition
lysosomal trafficking regulator
Organism
hsa  Homo sapiens (human)
Disease
H00101  
Other phagocyte defects
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.1-q42.2
AA seq 3801 aa AA seqDB search
MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEEKATDFNLPLSADIILTKEKNSSSQRSTQE
KLHLEGSALSSQVSAKVNVFRKSRRQRKITHRYSVRDARKTQLSTSDSEANSDEKGIAMN
KHRRPHLLHHFLTSFPKQDHPKAKLDRLATKEQTPPDAMALENSREIIPRQGSNTDILSE
PAALSVISNMNNSPFDLCHVLLSLLEKVCKFDVTLNHNSPLAASVVPTLTEFLAGFGDCC
SLSDNLESRVVSAGWTEEPVALIQRMLFRTVLHLLSVDVSTAEMMPENLRKNLTELLRAA
LKIRICLEKQPDPFAPRQKKTLQEVQEDFVFSKYRHRALLLPELLEGVLQILICCLQSAA
SNPFYFSQAMDLVQEFIQHHGFNLFETAVLQMEWLVLRDGVPPEASEHLKALINSVMKIM
STVKKVKSEQLHHSMCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSKNPFEETADGD
VYYPERCCCIAVCAHQCLRLLQQASLSSTCVQILSGVHNIGICCCMDPKSVIIPLLHAFK
LPALKNFQQHILNILNKLILDQLGGAEISPKIKKAACNICTVDSDQLAQLEETLQGNLCD
AELSSSLSSPSYRFQGILPSSGSEDLLWKWDALKAYQNFVFEEDRLHSIQIANHICNLIQ
KGNIVVQWKLYNYIFNPVLQRGVELAHHCQHLSVTSAQSHVCSHHNQCLPQDVLQIYVKT
LPILLKSRVIRDLFLSCNGVSQIIELNCLNGIRSHSLKAFETLIISLGEQQKDASVPDID
GIDIEQKELSSVHVGTSFHHQQAYSDSPQSLSKFYAGLKEAYPKRRKTVNQDVHINTINL
FLCVAFLCVSKEAESDRESANDSEDTSGYDSTASEPLSHMLPCISLESLVLPSPEHMHQA
ADIWSMCRWIYMLSSVFQKQFYRLGGFRVCHKLIFMIIQKLFRSHKEEQGKKEGDTSVNE
NQDLNRISQPKRTMKEDLLSLAIKSDPIPSELGSLKKSADSLGKLELQHISSINVEEVSA
TEAAPEEAKLFTSQESETSLQSIRLLEALLAICLHGARTSQQKMELELPNQNLSVESILF
EMRDHLSQSKVIETQLAKPLFDALLRVALGNYSADFEHNDAMTEKSHQSAEELSSQPGDF
SEEAEDSQCCSFKLLVEEEGYEADSESNPEDGETQDDGVDLKSETEGFSASSSPNDLLEN
LTQGEIIYPEICMLELNLLSASKAKLDVLAHVFESFLKIIRQKEKNVFLLMQQGTVKNLL
GGFLSILTQDDSDFQACQRVLVDLLVSLMSSRTCSEELTLLLRIFLEKSPCTKILLLGIL
KIIESDTTMSPSQYLTFPLLHAPNLSNGVSSQKYPGILNSKAMGLLRRARVSRSKKEADR
ESFPHRLLSSWHIAPVHLPLLGQNCWPHLSEGFSVSLWFNVECIHEAESTTEKGKKIKKR
NKSLILPDSSFDGTESDRPEGAEYINPGERLIEEGCIHIISLGSKALMIQVWADPHNATL
IFRVCMDSNDDMKAVLLAQVESQENIFLPSKWQHLVLTYLQQPQGKRRIHGKISIWVSGQ
RKPDVTLDFMLPRKTSLSSDSNKTFCMIGHCLSSQEEFLQLAGKWDLGNLLLFNGAKVGS
QEAFYLYACGPNHTSVMPCKYGKPVNDYSKYINKEILRCEQIRELFMTKKDVDIGLLIES
LSVVYTTYCPAQYTIYEPVIRLKGQMKTQLSQRPFSSKEVQSILLEPHHLKNLQPTEYKT
IQGILHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIKYNQQRVHELENCNGLSM
IHQVLIKQKCIVGFYILKTLLEGCCGEDIIYMNENGEFKLDVDSNAIIQDVKLLEELLLD
WKIWSKAEQGVWETLLAALEVLIRADHHQQMFNIKQLLKAQVVHHFLLTCQVLQEYKEGQ
LTPMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHPPTNTYVCHNPTNFYFSLHI
DGKIFQEKVRSIMYLRHSSSGGRSLMSPGFMVISPSGFTASPYEGENSSNIIPQQMAAHM
LRSRSLPAFPTSSLLTQSQKLTGSLGCSIDRLQNIADTYVATQSKKQNSLGSSDTLKKGK
EDAFISSCESAKTVCEMEAVLSAQVSVSDVPKGVLGFPVVKADHKQLGAEPRSEDDSPGD
ESCPRRPDYLKGLASFQRSHSTIASLGLAFPSQNGSAAVGRWPSLVDRNTDDWENFAYSL
GYEPNYNRTASAHSVTEDCLVPICCGLYELLSGVLLILPDVLLEDVMDKLIQADTLLVLV
NHPSPAIQQGVIKLLDAYFARASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFIEMF
FGRHIGLDEEFDLEDVRNMGLFQKWSVIPILGLIETSLYDNILLHNALLLLLQILNSCSK
VADMLLDNGLLYVLCNTVAALNGLEKNIPMSEYKLLACDIQQLFIAVTIHACSSSGSQYF
RVIEDLIVMLGYLQNSKNKRTQNMAVALQLRVLQAAMEFIRTTANHDSENLTDSLQSPSA
PHHAVVQKRKSIAGPRKFPLAQTESLLMKMRSVANDELHVMMQRRMSQENPSQATETELA
QRLQRLTVLAVNRIIYQEFNSDIIDILRTPENVTQSKTSVFQTEISEENIHHEQSSVFNP
FQKEIFTYLVEGFKVSIGSSKASGSKQQWTKILWSCKETFRMQLGRLLVHILSPAHAAQE
RKQIFEIVHEPNHQEILRDCLSPSLQHGAKLVLYLSELIHNHQGELTEEELGTAELLMNA
LKLCGHKCIPPSASTKADLIKMIKEEQKKYETEEGVNKAAWQKTVNNNQQSLFQRLDSKS
KDISKIAADITQAVSLSQGNERKKVIQHIRGMYKVDLSASRHWQELIQQLTHDRAVWYDP
IYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLRDRQKSEDVVKPPLSYLFEDKTHSS
FSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESSSLQGEL
EPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILTNNLP
NLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYVSETLDL
NDLLIYRNLSKPIAVQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNS
GTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYL
PEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDYVSQNICQWIDL
VFGYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFHMAHV
SRPGAKLNIEGELPAAVGLLVQFAFRETREQVKEITYPSPLSWIKGLKWGEYVGSPSAPV
PVVCFSQPHGERFGSLQALPTRAICGLSRNFCLLMTYSKEQGVRSMNSTDIQWSAILSWG
YADNILRLKSKQSEPPVNFIQSSQQYQVTSCAWVPDSCQLFTGSKCGVITAYTNRFTSST
PSEIEMETQIHLYGHTEEITSLFVCKPYSILISVSRDGTCIIWDLNRLCYVQSLAGHKSP
VTAVSASETSGDIATVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEGVSIN
VIAGGLENGIVRLWSTWDLKPVREITFPKSNKPIISLTFSCDGHHLYTANSDGTVIAWCR
KDQQRLKQPMFYSFLSSYAAG
NT seq 11406 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacagtaactcactggcacgtgaatttctgaccgatgtcaaccggctttgc
aatgcagtggtccagagggtggaggccagggaggaagaagaggaggagacgcacatggca
acccttggacagtaccttgtccatggtcgaggatttctattacttaccaagctaaattct
ataattgatcaggcattgacatgtagagaagaactcctgactcttcttctgtctctcctt
ccactggtatggaagatacctgtccaagaagaaaaggcaacagattttaacctaccgctc
tcagcagatataatcctgaccaaagaaaagaactcaagttcacaaagatccactcaggaa
aaattacatttagaaggaagtgccctgtctagtcaggtttctgcaaaagtaaatgttttt
cgaaaaagcagacgacagcgtaaaattacccatcgctattctgtaagagatgcaagaaag
acacagctctccacctcagattcagaagccaattcagatgaaaaaggcatagcaatgaat
aagcatagaaggccccatctgctgcatcattttttaacatcgtttcctaaacaagaccac
cccaaagctaaacttgaccgcttagcaaccaaagaacagactcctccagatgctatggct
ttggaaaattccagagagattattccaagacaggggtcaaacactgacattttaagtgag
ccagctgccttgtctgttatcagtaacatgaacaattctccatttgacttatgtcatgtt
ttgttatctttattagaaaaagtttgtaagtttgacgttaccttgaatcataattctcct
ttagcagccagtgtagtgcccacactaactgaattcctagcaggctttggggactgctgc
agtctgagcgacaacttggagagtcgagtagtttctgcaggttggaccgaagaaccggtg
gctttgattcaaaggatgctctttcgaacagtgttgcatcttctgtcagtagatgttagt
actgcagagatgatgccagaaaatcttaggaaaaatttaactgaattgcttagagcagct
ttaaaaattagaatatgcctagaaaagcagcctgacccttttgcaccaagacaaaagaaa
acactgcaggaggttcaggaagattttgtgttttcaaagtatcgtcatagagcccttctt
ttacctgagcttttggaaggagttcttcagattctgatctgttgtcttcaaagtgcagct
tcaaatcccttctacttcagtcaagccatggatttggttcaagaattcattcagcatcat
ggatttaatttatttgaaacagcagttcttcaaatggaatggctggttttaagagatgga
gttcctcccgaggcctcagagcatttgaaagccctaataaatagtgtgatgaaaataatg
agcactgtcaaaaaagtgaaatcagagcaacttcatcattcgatgtgtacaagaaaaagg
cacagacgatgtgaatattctcattttatgcatcatcaccgagatctctcaggtcttctg
gtttcggcttttaaaaaccaggtttccaaaaacccatttgaagagactgcagatggagat
gtttattatcctgagcggtgctgttgcattgcagtgtgtgcccatcagtgcttgcgctta
ctacagcaggcttccttgagcagcacttgtgtccagatcctatcgggtgttcataacatt
ggaatatgctgttgtatggatcccaaatctgtaatcattcctttgctccatgcttttaaa
ttgccagcactgaaaaattttcagcagcatatattgaatatccttaacaaacttattttg
gatcagttaggaggagcagagatatcaccaaaaattaaaaaagcagcttgtaatatttgt
actgttgactctgaccaactagcccaattagaagagacactgcagggaaacttatgtgat
gctgaactctcctcaagtttatccagtccttcttacagatttcaagggatcctgcccagc
agtggatctgaagatttgttgtggaaatgggatgctttaaaggcttatcagaactttgtt
tttgaagaagacagattacatagtatacagattgcaaatcacatttgcaatttaatccag
aaaggcaatatagttgttcagtggaaattatataattacatatttaatcctgtgctccaa
agaggagttgaattagcacatcattgtcaacacctaagcgttacttcagctcaaagtcat
gtatgtagccatcataaccagtgcttgcctcaggacgtgcttcagatttatgtaaaaact
ctgcctatcctgcttaaatccagggtaataagagatttgtttttgagttgtaatggagta
agtcaaataatcgaattaaattgcttaaatggtattcgaagtcattctctaaaagcattt
gaaactctgataatcagcctaggggagcaacagaaagatgcctcagttccagatattgat
gggatagacattgaacagaaggagttgtcctctgtacatgtgggtacttcttttcatcat
cagcaagcttattcagattctcctcagagtctcagcaaattttatgctggcctcaaagaa
gcttatccaaagagacggaagactgttaaccaagatgttcatatcaacacaataaaccta
ttcctctgtgtggcttttttatgcgtaagtaaagaagcagagtctgacagggagtcggcc
aatgactcagaagatacttctggctatgacagcacagccagcgagcctttaagtcatatg
ctgccatgtatatctctcgagagccttgtcttgccttctcctgaacatatgcaccaagca
gcagacatttggtctatgtgtcgttggatctacatgttgagttcagtgttccagaaacag
ttttataggcttggtggtttccgagtatgccataagttaatatttatgataatacagaaa
ctgttcagaagtcacaaagaggagcaaggaaaaaaggagggagatacaagtgtaaatgaa
aaccaggatttaaacagaatttctcaacctaagagaactatgaaggaagatttattatct
ttggctataaaaagtgaccccataccatcagaactaggtagtctaaaaaagagtgctgac
agtttaggtaaattagagttacagcatatttcttccataaatgtggaagaagtttcagct
actgaagccgctcccgaggaagcaaagctatttacaagtcaagaaagtgagacctcactt
caaagtatacgacttttggaagcccttctggccatttgtcttcatggtgccagaactagt
caacagaagatggaattggagttacctaatcagaacttgtctgtggaaagtatattattt
gaaatgagggaccatctttcccagtcaaaggtgattgaaacacaactagcaaagccttta
tttgatgccctgcttcgagttgccctcgggaattattcagcagattttgaacataatgat
gctatgactgagaagagtcatcaatctgcagaagaattgtcatcccagcctggtgatttt
tcagaagaagctgaggattctcagtgttgtagttttaaacttttagttgaagaagaaggt
tacgaagcagatagtgaaagcaatcctgaagatggcgaaacccaggatgatggggtagac
ttaaagtctgaaacagaaggtttcagtgcatcaagcagtccaaatgacttactcgaaaac
ctcactcaaggggaaataatttatcctgagatttgtatgctggaattaaatttgctttct
gctagtaaagccaaacttgatgtgcttgcccatgtatttgagagttttttgaaaattatt
aggcagaaagaaaagaatgtttttctgctcatgcaacagggaactgtgaaaaatctttta
ggagggttcttgagtattttaacacaggatgattctgattttcaagcatgccagagagta
ttggtggatcttttggtatctttgatgagttcaagaacatgttcagaagagctaaccctt
cttttgagaatatttctggagaaatctccttgtacaaaaattcttcttctgggtattctg
aaaattattgaaagtgatactactatgagcccttcacagtatctaaccttccctttactg
cacgctccaaatttaagcaacggtgtttcatcacaaaagtatcctgggattttaaacagt
aaggccatgggtttattgagaagagcacgagtttcacggagcaagaaagaggctgataga
gagagttttccccatcggctgctttcatcttggcacatagccccagtccacctgccgttg
ctggggcaaaactgctggccacacctatcagaaggtttcagtgtttccctgtggtttaat
gtggagtgtatccatgaagctgagagtactacagaaaaaggaaagaagataaagaaaaga
aacaaatcattaattttaccagatagcagttttgatggtacagagagcgacagaccagaa
ggtgcagagtacataaatcctggtgaaagactcatagaagaaggatgtattcatataatt
tcactgggatccaaagcgttgatgatccaagtgtgggctgatccccacaatgccactctt
atctttcgtgtgtgcatggattcaaatgatgacatgaaagctgttttactagcacaggtt
gaatcacaggagaatattttcctcccaagcaaatggcaacatttagtactcacctactta
cagcagccccaagggaaaaggaggattcatgggaaaatctccatatgggtctctggacag
aggaagcctgatgttactttggattttatgcttccaagaaaaacaagtttgtcatctgat
agcaataaaacattttgcatgattggccattgtttatcatcccaagaagagtttttgcag
ttggctggaaaatgggacctgggaaatttgcttctcttcaacggagctaaggttggttca
caagaggccttttatctgtatgcttgtggacccaaccatacatctgtaatgccatgtaag
tatggcaagccagtcaatgactactccaaatatattaataaagaaattttgcgatgtgaa
caaatcagagaactttttatgaccaagaaagatgtggatattggtctcttaattgaaagt
ctttcagttgtttatacaacttactgtcctgctcagtataccatctatgaaccagtgatt
agacttaaaggtcaaatgaaaacccaactctctcaaagacccttcagctcaaaagaagtt
cagagcatcttattagaacctcatcatctaaagaatctccaacctactgaatataaaact
attcaaggcattctgcacgaaattggtggaactggcatatttgtttttctctttgccagg
gttgttgaactcagtagctgtgaagaaactcaagcattagcactgcgagttatactctca
ttaattaaatacaaccaacaaagagtacatgaattagaaaattgtaatggactttctatg
attcatcaggtgttgatcaaacaaaaatgcattgttgggttttacattttgaagaccctt
cttgaaggatgctgtggtgaagatattatttatatgaatgagaatggagagtttaagttg
gatgtagactctaatgctataatccaagatgttaagctgttagaggaactattgcttgac
tggaagatatggagtaaagcagagcaaggtgtttgggaaactttgctagcagctctagaa
gtcctcatcagagcagatcaccaccagcagatgtttaatattaagcagttattgaaagct
caagtggttcatcactttctactgacttgtcaggttttgcaggaatacaaagaggggcaa
ctcacacccatgccccgagaggtttgtagatcatttgtgaaaattatagcagaagtcctt
ggatctcctccagatttggaattattgacaattatcttcaatttccttttagcagttcac
cctcctactaatacttacgtttgtcacaatcccacgaacttctacttttctttgcacata
gatggcaagatctttcaggagaaagtgcggtcaatcatgtacctgaggcattccagcagt
ggaggaaggtcccttatgagccctggatttatggtaataagcccatctggttttactgct
tcaccatatgaaggagagaattcctctaatattattccacaacagatggccgcccatatg
ctgcgttctagaagcctaccagcattccctacttcttcactactaacgcaatcacaaaaa
ctgactggaagtttgggttgtagtatcgacaggttacaaaatattgcagatacttatgtt
gccacccaatcaaagaaacaaaattctttggggagttccgacacactgaaaaaaggcaaa
gaggacgcattcatcagtagctgtgagtctgcaaaaactgtttgtgaaatggaagctgtc
ctctcagcccaggtctctgtcagtgatgtcccaaagggagtgctgggatttccagtggtc
aaagcagatcataaacagttgggagcagaacccaggtcagaagatgacagtcctggggat
gagtcctgcccacgccgacctgattacctaaagggattggcctccttccagcgaagccac
agcactattgcaagccttgggctagcttttccttcacagaacggatctgcagctgttggc
cgttggccaagtcttgttgatagaaacactgatgattgggaaaactttgcctattctctt
ggttatgagccaaattacaaccgaactgcaagtgctcacagtgtaactgaagactgtttg
gtacctatatgctgtggattatatgaactcctaagtggggttcttcttatcctgcctgat
gttttgcttgaagatgtgatggacaagcttattcaagcagatacacttttggtcctcgtt
aaccacccatcaccagctatacaacaaggtgttattaaactattagatgcatattttgct
agagcatctaaggaacaaaaagataaatttctgaagaatcgtggattttccttgctagcc
aaccagttgtatcttcatcgaggaactcaagaattgttagaatgcttcatcgaaatgttc
tttggtcgacatattggccttgatgaagaatttgatctggaagatgtgagaaacatggga
ttgtttcagaagtggtctgtcattcctattctgggactaatagagacctctctatatgac
aacatactcttgcataatgctcttttacttcttctccaaattttaaattcttgttctaag
gtagcagatatgttgctggataatggtctactctatgtgttatgtaatacagtagcagcc
ctgaatggattagaaaagaacattcccatgagtgaatataaattgcttgcttgtgatata
cagcaacttttcatagcagttacaattcatgcttgcagttcctcaggctcacaatatttt
agggttattgaagaccttattgtaatgcttggatatcttcaaaatagcaaaaacaagagg
acacaaaatatggctgttgcactacagcttagagttctccaggctgctatggaatttata
aggaccaccgcaaatcatgactctgaaaacctcacagattcactccagtcaccttctgct
ccccatcatgcagtagttcaaaagcggaaaagcattgctggtcctcgaaaatttcccctt
gctcaaactgaatcgcttctgatgaaaatgcgttcagtggcaaatgatgagcttcatgtg
atgatgcaacggagaatgagccaagagaaccctagccaagcaactgaaacggaacttgcg
cagagactacagaggctcactgttttagcagtcaacaggattatttatcaagaatttaat
tcagacattattgacattttgagaactccagaaaatgtaactcaaagcaagacctcagtt
ttccagaccgaaatttctgaggaaaatattcatcatgaacagtcttctgttttcaatcca
tttcagaaagaaatttttacatatctggtagaaggattcaaagtatctattggttcaagt
aaagccagtggttccaagcagcaatggactaaaattctgtggtcttgtaaggagaccttc
cgaatgcagcttgggagactactagtgcatattttgtcgccagcccacgctgcacaagag
agaaagcaaatttttgaaatagttcatgaaccaaatcatcaggaaatactacgagactgt
ctcagcccatccctacaacatggagccaagttagttttgtatttgtcagagttgatacat
aatcaccaaggtgaattgactgaagaagagctaggcacagcagaactgcttatgaatgct
ttgaagttatgtggtcacaagtgcatccctcccagtgcatcaacaaaagcagaccttatt
aaaatgatcaaagaggaacaaaagaaatatgaaactgaagaaggagtgaataaagctgct
tggcagaaaacagttaacaataatcaacaaagtctctttcagcgtctggattcaaaatca
aaggatatatctaaaatagctgcagatatcacccaggcagtgtctctctcccaaggaaat
gagagaaaaaaggtgatccagcatattagaggaatgtataaagtagatttgagtgccagc
agacattggcaggaacttattcagcagctgacacatgatagagcagtatggtatgacccc
atctactatccaacctcatggcagttggatccaacagaagggccaaatcgagagaggaga
cgtttacagagatgttatttaactattccaaataagtatctccttagggatagacagaaa
tcagaagatgttgtcaaaccaccactctcttacctgtttgaagacaaaactcattcttct
ttctcttctactgtcaaagacaaagctgcaagtgaatctataagagtgaatcgaagatgc
atcagtgttgcaccatctagagagacagctggtgaattgttactaggtaaatgtggaatg
tattttgtggaagataatgcttctgatacagttgaaagttcgagccttcagggagagttg
gaaccagcatcattttcctggacatatgaagaaattaaagaagttcacaagcgttggtgg
caattgagagataatgctgtagaaatctttctaacaaatggcagaacactcctgttggca
tttgataacaccaaggttcgtgatgatgtataccacaatatactcacaaataacctccct
aatcttctggaatatggtaacatcaccgctctgacaaatttatggtatactgggcaaatt
actaattttgaatatttgactcacttaaacaaacatgctggccgatccttcaatgatctc
atgcagtatcctgtgttcccatttatacttgctgactacgttagtgagacacttgacctc
aatgatctgttgatatacagaaatctctctaaacctatagctgttcagtataaagaaaaa
gaagatcgttatgtggacacatacaagtacttggaggaagagtaccgcaaaggagccaga
gaagatgaccccatgcctcccgtgcagccctatcactatggctcccactattccaatagc
ggcactgtgcttcacttcctggtcaggatgcctcctttcactaaaatgtttttagcctat
caagatcaaagttttgacattccagacagaacttttcattctacaaatacaacttggcga
ctctcatcttttgaatctatgactgatgtgaaagaacttatcccagagtttttctatctt
ccagagttcctagttaaccgtgaaggttttgattttggtgtgcgtcagaatggtgaacgg
gttaatcacgtcaaccttcccccttgggcgcgtaatgatcctcgtctttttatcctcatc
catcggcaggctctagagtctgactacgtgtcgcagaacatctgtcagtggattgacttg
gtgtttgggtataagcaaaaggggaaggcttctgttcaagcgatcaatgtttttcatcct
gctacatattttggaatggatgtctctgcagttgaagatccagttcagagacgagcgcta
gaaaccatgataaaaacctacgggcagactccccgtcagctgttccacatggcccatgtg
agcagacctggagccaagctcaatattgaaggagagcttccagctgctgtggggttgcta
gtgcagtttgctttcagggagacccgagaacaggtcaaagaaatcacctatccgagtcct
ttgtcatggataaaaggcttgaaatggggggaatacgtgggttcccccagtgctccagta
cctgtggtctgcttcagccagccccacggagaaagatttggctctctccaggctctgccc
accagagcaatctgtggtttgtcacggaatttctgtcttctgatgacatatagcaaggaa
caaggtgtgagaagcatgaacagtacggacattcagtggtcagccatcctgagctgggga
tatgctgataatattttaaggttgaagagtaaacaaagtgagcctccagtaaactttatt
caaagttcacaacagtaccaggtgactagttgtgcttgggtgcctgacagttgccagctg
tttactggaagcaaatgcggtgtcatcacagcctacacaaacagatttacaagcagcacg
ccatcagaaatagaaatggagactcaaatacatctctatggtcacacagaagagataacc
agcttatttgtttgcaaaccatacagtatactgataagtgtgagcagagacggaacctgc
atcatatgggatttaaacaggttatgctatgtacaaagtctggcgggacacaaaagccct
gtcacagctgtctctgccagtgaaacctcaggtgatattgctactgtgtgtgattcagct
ggcggaggcagtgacctcagactctggacggtgaacggggatctcgttggacatgtccac
tgcagggagatcatctgttccgtggctttctccaaccagcctgagggagtatctatcaat
gtaatcgctgggggattagaaaatggaattgtaaggttatggagcacatgggacttaaag
cctgtgagagaaattacatttcccaaatcaaataagcccatcatcagccttacattttct
tgtgatggccaccatttgtacacagcaaacagtgatgggaccgtgattgcctggtgtcgg
aaggaccagcagcgcttgaaacagccaatgttctattccttccttagcagctatgcagcc
gggtga

DBGET integrated database retrieval system