KEGG   Homo sapiens (human): 113278Help
Entry
113278            CDS       T01001                                 

Gene name
SLC52A3, BVVLS, BVVLS1, C20orf54, RFT2, RFVT3, bA371L19.1, hRFT2
Definition
(RefSeq) solute carrier family 52 member 3
  KO
K14620  riboflavin transporter 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04977  Vitamin digestion and absorption
Disease
H00841  Infantile progressive bulbar palsy
H01903  Brown-Vialetto-Van Laere syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    113278 (SLC52A3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC52: Riboflavin transporter
   113278 (SLC52A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1011
Motif
Other DBs
NCBI-GeneID: 113278
NCBI-ProteinID: NP_212134
OMIM: 613350
HGNC: 16187
Ensembl: ENSG00000101276
Vega: OTTHUMG00000031647
Pharos: Q9NQ40(Tbio)
UniProt: Q9NQ40 K0A6P4
Position
20p13
AA seq 469 aa AA seqDB search
MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTL
LHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDC
TSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPV
PTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFV
LQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
AFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSL
LFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVV
LRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSADFCNLHCPA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctgatgcacctgctggtctgcgtcttcggaatgggctcctgggtgaccatc
aatgggctctgggtagagctgcccctgctggtgatggagctgcccgagggctggtacctg
ccctcctacctcacggtggtcatccagctggccaacatcgggcccctcctggtcaccctg
ctccatcacttccggcccagctgcctttccgaagtgcccatcatcttcaccctgctgggc
gtgggaaccgtcacctgcatcatctttgccttcctctggaatatgacctcctgggtgctg
gacggccaccacagcatcgccttcttggtcctcaccttcttcctggccctggtggactgc
acctcttcagtgaccttcctgccgttcatgagccggctgcccacctactacctcaccacc
ttctttgtgggtgaaggactcagcggcctcttgcccgccctggtggctcttgcccagggc
tccggtctcactacctgcgtcaatgtcactgagatatcagacagcgtaccaagccctgta
cccacgagggagactgacatcgcacagggagttcccagagctttggtgtccgccctcccc
ggaatggaagcacccttgtcccacctggagagccgctaccttcccgcccacttctcaccc
ctggtcttcttcctcctcctatccatcatgatggcctgctgcctcgtggcgttctttgtc
ctccagcgtcaacccaggtgctgggaggcttccgtggaagacctcctcaatgaccaggtc
accctccactccatccggccgcgggaagagaatgacttgggccctgcaggcacggtggac
agcagccagggccaggggtatctagaggagaaagcagccccctgctgcccggcgcacctg
gccttcatctataccctggtggccttcgtcaacgcgctcaccaacggcatgctgccctct
gtgcagacctactcctgcctgtcctatgggccagttgcctaccacctggctgccaccctc
agcattgtggccaaccctcttgcctcgttggtctccatgttcctgcctaacaggtctctg
ctgttcctgggggtcctctccgtgcttgggacctgctttgggggctacaacatggccatg
gcggtgatgagcccctgccccctcttgcagggccactggggtggggaagtcctcattgtg
gcctcgtgggtgcttttcagcggctgcctcagttacgtcaaggtgatgctgggcgtggtc
ctgcgcgacctcagccgcagcgccctcttgtggtgcggggcggcggtgcagctgggctcg
ctgctcggagcgctgctcatgttccctctggtcaacgtgctgcggctcttctcgtccgcg
gacttctgcaatctgcactgtccagcctag

DBGET integrated database retrieval system