KEGG   Homo sapiens (human): 1145Help
Entry
1145              CDS       T01001                                 

Gene name
CHRNE, ACHRE, CMS1D, CMS1E, CMS2A, FCCMS, SCCMS
Definition
cholinergic receptor, nicotinic, epsilon (muscle)
Orthology
K04817  
nicotinic acetylcholine receptor epsilon
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00770  
Congenital myasthenic syndrome
Drug target
Mecamylamine: 
Tubocurarine: 
Dimethyltubocurarine: 
Suxamethonium: 
Pancuronium: 
Gallamine: 
Vecuronium: 
Atracurium: 
Pipecuronium bromide: 
Doxacurium chloride: 
Rocuronium bromide: 
Mivacurium chloride: 
Cisatracurium: 
Acetylcholine: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.2
AA seq 493 aa AA seqDB search
MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL
ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQF
GVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTF
AVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKP
LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLS
VPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPP
EAPRAASPPRRASSVGLLLRAEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEV
RCCVDAVNFVAESTRDQEATGEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFN
RVPDLPYAPCIQP
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcaagggctccgcttggggtcctgctcctcttggggcttctcggcaggggtgtgggg
aagaacgaggaactgcgtctttatcaccatctcttcaacaactatgacccaggaagccgg
ccagtgcgggagcctgaggatactgtcaccatcagcctcaaggtcaccctgacgaatctc
atctcactgaatgaaaaagaggagactctcaccactagcgtctggattggaatcgattgg
caggattaccgactcaactacagcaaggacgactttgggggtatagaaaccctgcgagtc
ccttcagaactcgtgtggctgccagagattgtgctggaaaacaatattgatggccagttc
ggagtggcctacgacgccaacgtgctcgtctacgagggcggctccgtgacgtggctgcct
ccggccatctaccgcagcgtctgcgcagtggaggtcacctacttccccttcgattggcag
aactgttcgcttattttccgctctcagacgtacaatgccgaagaggtggagttcactttt
gccgtagacaacgacggcaagaccatcaacaagatcgacatcgacacagaggcctatact
gagaacggcgagtgggccatcgacttctgcccgggggtgatccgccgccaccacggtggc
gccaccgacggcccaggggagactgacgtcatctactcgctcatcatccgccggaagccg
ctcttctacgtcattaacatcatcgtgccctgtgtgctcatctcgggcctggtgctgctc
gcctacttcctgccggcgcaggccggcggccagaaatgcacggtctccatcaacgtcctg
ctcgcccagaccgtcttcttgttcctcattgcccagaaaatcccagagacttctctgagc
gtgccgctcctgggcaggttccttattttcgtcatggtggtcgccacgctcattgtcatg
aattgcgtcatcgtgctcaacgtgtcccagcggacgcccaccacccacgccatgtccccg
cggctgcgccacgttctcctggagctgctgccgcgcctcctgggctccccgccgccgccc
gaggccccccgggccgcctcgcccccaaggcgggcgtcgtcggtgggcttattgctccgc
gcggaggagctgatactgaaaaagccacggagcgagctcgtgtttgaggggcagaggcac
cggcaggggacctggacggctgccttctgccagagcctgggcgccgccgcccccgaggtc
cgctgctgtgtggatgccgtgaacttcgtggccgagagcacgagagatcaggaggccacc
ggcgaggaagtgtccgactgggtgcgcatggggaatgcccttgacaacatctgcttctgg
gccgctctggtgctcttcagcgtgggctccagcctcatcttcctcggggcctacttcaac
cgagtgcctgatctcccctacgcgccgtgtatccagccttag

DBGET integrated database retrieval system