KEGG   Homo sapiens (human): 1146Help
Entry
1146              CDS       T01001                                 

Gene name
CHRNG, ACHRG
Definition
(RefSeq) cholinergic receptor nicotinic gamma subunit
  KO
K04818  
nicotinic acetylcholine receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00986  
Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): 
Atracurium (DG00771): 
Cisatracurium: 
Dimethyltubocurarine: 
Doxacurium chloride: 
Fazadinium bromide: 
Gallamine: 
Gantacurium chloride: 
Lobeline (DG01287): 
Mecamylamine (DG00252): 
Mivacurium chloride: 
Pancuronium (DG00769): 
Pipecuronium bromide: 
Rapacuronium bromide: 
Rocuronium bromide: 
Suxamethonium (DG00768): 
Trimetaphan (DG00251): 
Tubocurarine (DG00767): 
Vecuronium (DG00770): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1146 (CHRNG)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   1146 (CHRNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.1
AA seq 517 aa AA seqDB search
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLT
NLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDG
VFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDL
QLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
PLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQ
AVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVR
PLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGP
ELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAM
LSLFICGTAGIFLMAHYNRVPALPFPGDPRPYLPSPD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcatgggggccaggggccgctgctcctcctgctgctgctggctgtctgcctgggggcc
cagggccggaaccaggaggagcgcctgctcgcagacctgatgcaaaactacgaccccaac
ctgcggcccgcggaacgagactcggatgtggtcaatgtcagcctgaagctaaccctcacc
aacctcatctccctgaacgagcgagaggaagccctcaccaccaatgtctggatagagatg
cagtggtgcgactatcgcctgcgctgggatccgcgagactacgaaggcctgtgggtgctg
agggtgccgtccaccatggtgtggcggccggatatcgtgctggagaacaacgtggacggt
gtcttcgaggtggccctctactgcaatgtgctcgtgtcccctgacggctgtatctactgg
ctgccgcctgccatcttccgttccgcctgctctatctcagtcacctacttccccttcgac
tggcagaactgctcccttatcttccagtcccagacttacagcaccaatgagattgatctg
cagctgagtcaggaagatggccagaccatcgagtggattttcattgaccctgaggccttc
acagagaatggggagtgggccatccagcaccgaccagccaagatgctcctggacccagcg
gcgccagcccaggaagcaggccaccagaaggtggtgttctacctgctcatccagcgcaag
cccctcttctacgtcatcaacatcatcgccccctgtgtgctcatctcctctgtcgccatc
ctcatccacttccttcctgccaaggctgggggccagaagtgtaccgtcgccatcaacgtg
ctcctggcccagactgtcttcctcttccttgtggccaagaaggtgcctgaaacctcccag
gcggtgccactcatcagcaagtacctgaccttcctcctggtggtgaccatcctcattgtc
gtgaatgctgtggttgtgctcaatgtctccttgcggtctccacacacacactccatggcc
cgaggggtccgcaaggtgttcctgaggctcttgccccagctgctgaggatgcacgttcgc
ccgctggccccggcagctgtgcaggacacccagtcccggctacagaatggctcctcggga
tggtcgatcacaactggggaggaggtggccctctgcctgcctcgcagtgaactcctcttc
cagcagtggcagcggcaagggctggtggcggcagcgctggagaagctagagaaaggcccg
gagttagggctgagccagttctgtggcagcctgaagcaggctgccccagccatccaggcc
tgtgtggaagcctgcaacctcattgcctgtgcccggcaccagcagagtcactttgacaat
gggaatgaggagtggttcctggtgggccgagtgctggaccgcgtctgcttcctggccatg
ctctcgctcttcatctgtggcacagctggcatcttcctcatggcccactacaaccgggtg
ccggccctgccattccctggagatccacgcccctacctgccctcaccagactga

DBGET integrated database retrieval system