KEGG   Homo sapiens (human): 1161Help
Entry
1161              CDS       T01001                                 

Gene name
ERCC8, CKN1, CSA, UVSS2
Definition
excision repair cross-complementation group 8
Orthology
K10570  
DNA excision repair protein ERCC-8
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Disease
H00076  
Cockayne syndrome
H00403  
Disorders of nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1161 (ERCC8)
  Replication and repair
   03420 Nucleotide excision repair
    1161 (ERCC8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul4 complex
    target recognizing subunit (DCAF)
     1161 (ERCC8)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      1161 (ERCC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q12.1
AA seq 396 aa AA seqDB search
MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLDIEPVEGRYML
SGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA
NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVS
CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA
WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctggggtttttgtccgcacgccaaacgggtttggaggaccctcttcgccttcggaga
gcagagtcaacacggagagttttgggactggaattaaataaagacagagatgttgaaaga
atccacggcggtggaattaacacccttgacattgaacctgttgaagggagatacatgtta
tcaggtggttcagatggtgtgattgtactttatgaccttgagaactccagcagacaatct
tattacacatgtaaagcagtgtgttccattggcagagatcatcctgatgttcacagatac
agtgtggagactgtacagtggtatcctcatgacactggcatgttcacatcaagctcattt
gataaaactctgaaagtatgggatacaaatacattacaaactgcagatgtatttaatttt
gaggaaacagtttatagtcatcatatgtctccagtctccaccaagcactgtttggtagca
gttggtactagaggacccaaagtacaactttgtgacttgaagtctggatcctgttctcac
attctacagggtcacagacaagaaatattagcagtttcctggtctccacgttatgactat
atcttggcaacagcaagtgctgacagtagagtaaaattatgggatgtgagaagagcatca
ggatgtttgattactcttgatcaacataatgggaaaaagtcacaagctgttgaatcagca
aacactgctcataatgggaaagttaatggcttatgttttacaagtgatggacttcacctc
ctcactgttggtacagataatcgaatgaggctctggaatagttccaatggagaaaacaca
cttgtgaactatggaaaagtttgtaataacagtaaaaaaggattgaaattcactgtctcc
tgtggctgcagttcagaatttgtttttgtaccatatggtagcaccattgctgtttataca
gtttactcaggagaacagataactatgcttaagggacattataaaactgttgactgctgt
gtatttcagtcaaatttccaggaactttatagtggtagcagagactgcaacattctggct
tgggttccatccttatatgaaccagttcctgatgatgatgagactacaacaaaatcacaa
ttaaatccggcctttgaagatgcctggagcagcagtgatgaagaaggatga

DBGET integrated database retrieval system