KEGG   Homo sapiens (human): 1161Help
Entry
1161              CDS       T01001                                 

Gene name
ERCC8, CKN1, CSA, UVSS2
Definition
excision repair cross-complementing rodent repair deficiency, complementation group 8
Orthology
K10570  
DNA excision repair protein ERCC-8
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Disease
H00076  
Cockayne syndrome
H00403  
Disorders of nucleotide excision repair
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q12.1
AA seq 396 aa AA seqDB search
MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLDIEPVEGRYML
SGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA
NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVS
CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA
WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctggggtttttgtccgcacgccaaacgggtttggaggaccctcttcgccttcggaga
gcagagtcaacacggagagttttgggactggaattaaataaagacagagatgttgaaaga
atccacggcggtggaattaacacccttgacattgaacctgttgaagggagatacatgtta
tcaggtggttcagatggtgtgattgtactttatgaccttgagaactccagcagacaatct
tattacacatgtaaagcagtgtgttccattggcagagatcatcctgatgttcacagatac
agtgtggagactgtacagtggtatcctcatgacactggcatgttcacatcaagctcattt
gataaaactctgaaagtatgggatacaaatacattacaaactgcagatgtatttaatttt
gaggaaacagtttatagtcatcatatgtctccagtctccaccaagcactgtttggtagca
gttggtactagaggacccaaagtacaactttgtgacttgaagtctggatcctgttctcac
attctacagggtcacagacaagaaatattagcagtttcctggtctccacgttatgactat
atcttggcaacagcaagtgctgacagtagagtaaaattatgggatgtgagaagagcatca
ggatgtttgattactcttgatcaacataatgggaaaaagtcacaagctgttgaatcagca
aacactgctcataatgggaaagttaatggcttatgttttacaagtgatggacttcacctc
ctcactgttggtacagataatcgaatgaggctctggaatagttccaatggagaaaacaca
cttgtgaactatggaaaagtttgtaataacagtaaaaaaggattgaaattcactgtctcc
tgtggctgcagttcagaatttgtttttgtaccatatggtagcaccattgctgtttataca
gtttactcaggagaacagataactatgcttaagggacattataaaactgttgactgctgt
gtatttcagtcaaatttccaggaactttatagtggtagcagagactgcaacattctggct
tgggttccatccttatatgaaccagttcctgatgatgatgagactacaacaaaatcacaa
ttaaatccggcctttgaagatgcctggagcagcagtgatgaagaaggatga

DBGET integrated database retrieval system