KEGG   Homo sapiens (human): 1184Help
Entry
1184              CDS       T01001                                 

Gene name
CLCN5, CLC5, CLCK2, ClC-5, DENTS, NPHL1, NPHL2, XLRH, XRN, hCIC-K2
Definition
chloride channel, voltage-sensitive 5
Orthology
K05012  
chloride channel 3/4/5
Organism
hsa  Homo sapiens (human)
Disease
H00214  
Hypophosphatemic rickets
H00694  
Dent disease
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23-p11.22
AA seq 746 aa AA seqDB search
MDFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHSVSDAFSGWLL
MLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEHCCWNSEHVTFEERDKCPEWN
SWSQLIISTDEGAFAYIVNYFMYVLWALLFAFLAVSLVKVFAPYACGSGIPEIKTILSGF
IIRGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNILCHCFNKYRKNEAKRR
EVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGN
SRLVLFYVEFHTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTTQLGKYPVIEV
LVVTAITAILAFPNEYTRMSTSELISELFNDCGLLDSSKLCDYENRFNTSKGGELPDRPA
GVGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYH
QEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA
AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQ
DSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSII
YFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTHNGRLL
GIITKKDVLKHIAQMANQDPDSILFN
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggacttcttggaggagccaatccctggtgtagggacctatgatgatttcaatacaatt
gattgggtgagagagaagtctcgagaccgggataggcaccgagagattaccaataaaagc
aaagagtcaacatgggccttaattcacagtgtgagtgatgctttttccggctggttgttg
atgctccttattgggcttttatcaggttcgttagctggtttgatagacatctctgctcat
tggatgacagacttaaaagaaggtatatgcacagggggattctggtttaaccatgaacat
tgttgctggaactctgagcatgtcacctttgaagagagagacaaatgtccagagtggaat
agttggtcccagcttatcatcagcacagatgagggagcctttgcctacatagtcaattat
ttcatgtacgtcctctgggctctcctatttgccttccttgccgtatctcttgtcaaggtg
tttgcgccttatgcctgtggctctggaatccctgagataaaaactatcttgagtggtttc
attattaggggctatttgggtaagtggactctggttatcaaaaccatcaccttggtgctg
gcagtgtcatctggcttgagcctgggcaaagagggccctctagtgcacgtggcttgctgc
tgtgggaacatcctgtgccactgcttcaacaaatacaggaagaatgaagccaagcgcaga
gaggtcttgtcggctgcagcagcagctggtgtatctgtagcctttggagcacctataggt
ggagtattattcagccttgaagaggtcagctactattttcccctcaaaacattgtggcgt
tcattctttgctgccttggtggcagcattcactctacgctccatcaatccatttgggaac
agccgcctggtactattttatgtggagtttcacaccccatggcatctctttgagctcgtg
ccattcattctgctgggcatatttggtggtctgtggggagcactgtttatccgcacaaac
attgcctggtgtcggaagcgaaagaccacccagttgggcaagtatcctgttatagaggta
ctcgtcgtgacagccatcactgccatcctggctttccccaatgaatacactcggatgagc
acaagtgagctcatttctgagctgtttaatgactgtggccttctggactcctccaagctc
tgtgattatgagaaccgtttcaacacaagcaaagggggtgaactgcctgacagaccggct
ggcgtgggagtctacagtgcaatgtggcagctggctttaacactcatactgaaaattgtc
attactatattcacctttggcatgaagatcccttctggcctctttatccctagcatggct
gttggtgctatagcaggtcgacttctaggagtaggaatggaacagctggcttattaccac
caggaatggaccgtcttcaatagctggtgtagtcagggagctgattgcatcacccccggc
ctttatgcaatggttggggctgcagcctgcttaggtggggtgactcggatgactgtttct
cttgttgtcataatgtttgaactgactggtggcttagaatacatcgtgcctctgatggct
gcagccatgacaagcaagtgggtggcagatgctcttgggcgggagggcatctatgatgcc
cacatccgtctcaatggatacccctttcttgaagccaaagaagagtttgctcataagacc
ctggcaatggatgtgatgaaaccccggagaaatgatcctttgttgactgtccttactcag
gacagtatgactgtggaagatgtagagaccataatcagtgaaaccacttacagtggcttc
ccagtggtggtatcccgggagtcccaaagacttgtgggctttgtcctccgaagagatctc
attatttcaattgaaaatgctcgaaagaaacaggatggggttgttagcacttccatcatt
tatttcacggagcattctcctccattgccaccatacactccacccactctaaagcttcgg
aacatcctcgatctcagccccttcactgtgactgaccttacacccatggagatcgtagtg
gatattttccgaaagctgggactgcggcagtgcctggttacacacaacgggcgattgctt
ggaatcattaccaaaaaggatgtgttaaagcatatagcacagatggcgaaccaagatcct
gattccattctcttcaactag

DBGET integrated database retrieval system