KEGG   Homo sapiens (human): 1187Help
Entry
1187              CDS       T01001                                 

Gene name
CLCNKA, CLCK1, ClC-K1, hClC-Ka
Definition
chloride channel, voltage-sensitive Ka
Orthology
K05017  
chloride channel Ka
Organism
hsa  Homo sapiens (human)
Disease
H00239  
Bartter syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36
AA seq 686 aa AA seqDB search
MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDWYFLMTLGVLM
ALVSYAMNFAIGCVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGG
SGIPELKTMLAGVILEDYLDIKNFGAKVVGLSCTLATGSTLFLGKVGPFVHLSVMIAAYL
GRVRTTTIGEPENKSKQNEMLVAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVRDYWRGF
FAATCGAFIFRLLAVFNSEQETITSLYKTSFRVDVPFDLPEIFFFVALGGICGVLSCAYL
FCQRTFLSFIKTNRYSSKLLATSKPVYSALATLLLASITYPPGVGHFLASRLSMKQHLDS
LFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIP
MPAGYFMPIFILGAAIGRLLGEALAVAFPEGIVTGGVTNPIMPGGYALAGAAAFSGAVTH
TISTALLAFELTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTIIVKKLPYLPRILGRNI
GSHHVRVEHFMNHSITTLAKDTPLEEVVKVVTSTDVTEYPLVESTESQILVGIVQRAQLV
QALQAEPPSRAPGHQCLQDILARGCPTEPVTLTLFSETTLHQAQNLFKLLNLQSLFVTSR
GRAVGCVSWVEMKKAISNLTNPPAPK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggaggagttggtggggctgcgtgagggcttctcaggggaccctgtgactctgcaggag
ctgtggggcccctgtccccacatccgccgagccatccaaggtggcctggagtggctaaag
cagaaggtgttccgcctgggagaagactggtacttcctgatgaccctcggggtgctcatg
gccctggtcagctatgccatgaactttgccatcgggtgtgtggtccgagcacaccagtgg
ctgtacagggagattggggacagccacctgctccggtatctttcctggactgtgtaccct
gtggccctcgtctctttctcctcaggcttctcccagagcatcacgccctcctctggaggt
tctggaatcccggagctgaagaccatgttggcgggtgtgatcttggaggactacctggat
atcaagaactttggggccaaggtggtgggcctctcctgcaccctggccaccggcagcacc
ctgttcctgggcaaagtgggccctttcgtgcacctgtctgtaatgatcgctgcctacctg
ggccgtgtgcgcaccacgaccatcggggagcctgagaacaagagcaagcaaaacgaaatg
ctggtggcagcggcggcagtgggcgtggccacagtctttgcagctcccttcagcggcgtc
ctgttcagcatcgaggtcatgtcttcccacttctctgtccgggattactggaggggcttc
tttgcggccacctgcggggccttcatattccggctcctggcagtcttcaacagcgagcag
gagaccatcacctccctctacaagaccagtttccgggtggacgttcccttcgacctgcct
gagatcttcttttttgtggcgctgggtggcatctgcggcgtcctgagctgtgcttacctc
ttctgtcagcgaaccttcctcagcttcatcaagaccaatcggtacagctccaaactgctg
gctactagcaagcctgtgtactccgctctggccaccttgcttctcgcctccatcacctac
ccgcctggtgtgggccacttcctagcttctcggctgtccatgaagcagcatctggactcg
ctgttcgacaaccactcctgggcgctgatgacccagaactccagcccaccctggcccgag
gagctcgacccccagcacctttggtgggaatggtaccacccgcggttcaccatctttggg
acccttgccttcttcctggttatgaagttctggatgctgattctggccaccaccatcccc
atgcctgccgggtacttcatgcccatctttatccttggagctgccatcgggcgcctcttg
ggagaggctcttgccgtcgccttccctgagggcattgtgactggaggggttaccaatccc
atcatgcccggggggtatgctctggcaggggctgcagccttctcaggggctgtgacccac
accatctccacggcgctgctggcctttgagctgaccggccagatagtgcatgcactgccc
gtgctgatggcggtgctggcagccaacgccattgcacagagctgccagccctccttctat
gatggcaccatcattgtcaagaagctgccatacctgccacggattctgggccgcaacatc
ggctcccaccatgtgagggtggagcacttcatgaaccacagcatcaccacactggccaag
gacacgccgctggaggaggtggtcaaggttgtgacctccacagacgtgaccgagtatccc
ctggtggagagcacagagtcccagatcctggtaggcatcgtgcagagggcccagctggtg
caggccctccaggctgagcctccttccagggctccaggacaccagtgtctccaggacatc
ttggccaggggctgccccacggaaccagtgaccctgacgctattctcagagaccaccttg
caccaggcacaaaacctctttaagctgttgaaccttcagtccctcttcgtgacatcgcgg
ggcagagctgtgggctgcgtgtcctgggtggagatgaagaaagcaatttccaacctgaca
aatccgccagctccaaagtga

DBGET integrated database retrieval system