KEGG   Homo sapiens (human): 1201Help
Entry
1201              CDS       T01001                                 

Gene name
CLN3, BTN1, BTS, JNCL
Definition
(RefSeq) CLN3, battenin
  KO
K12389  
battenin
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00149  
Neuronal ceroid lipofuscinosis
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1201 (CLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
16p12.1
AA seq 438 aa AA seqDB search
MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAH
DILSHKRTSGNQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLH
LLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAV
ISWWSSGTGGAGLLGALSYLGLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPG
GEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVFKGLLWYIVPLVVVYFAEYFINQ
GLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLL
ADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGI
SLSGLLALPLHDFLCQLS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggaggctgtgcaggctcgcggcggcgcttttcggattccgagggggaggagaccgtc
ccggagccccggctccctctgttggaccatcagggcgcgcattggaagaacgcggtgggc
ttctggctgctgggcctttgcaacaacttctcttatgtggtgatgctgagtgccgcccac
gacatccttagccacaagaggacatcgggaaaccagagccatgtggacccaggcccaacg
ccgatcccccacaacagctcatcacgatttgactgcaactctgtctctacggctgctgtg
ctcctggcggacatcctccccacactcgtcatcaaattgttggctcctcttggccttcac
ctgctgccctacagcccccgggttctcgtcagtgggatttgtgctgctggaagcttcgtc
ctggttgccttttctcattctgtggggaccagcctgtgtggtgtggtcttcgctagcatc
tcatcaggccttggggaggtcaccttcctctccctcactgccttctaccccagggccgtg
atctcctggtggtcctcagggactgggggagctgggctgctgggggccctgtcctacctg
ggcctcacccaggccggcctctcccctcagcagaccctgctgtccatgctgggtatccct
gccctgctgctggccagctatttcttgttgctcacatctcctgaggcccaggaccctgga
ggggaagaagaagcagagagcgcagcccggcagcccctcataagaaccgaggccccggag
tcgaagccaggctccagctccagcctctcccttcgggaaaggtggacagtgttcaagggt
ctgctgtggtacattgttcccttggtcgtagtttactttgccgagtatttcattaaccag
ggactttttgaactcctctttttctggaacacttccctgagtcacgctcagcaataccgc
tggtaccagatgctgtaccaggctggcgtctttgcctcccgctcttctctccgctgctgt
cgcatccgtttcacctgggccctggccctgctgcagtgcctcaacctggtgttcctgctg
gcagacgtgtggttcggctttctgccaagcatctacctcgtcttcctgatcattctgtat
gaggggctcctgggaggcgcagcctacgtgaacaccttccacaacatcgccctggagacc
agtgatgagcaccgggagtttgcaatggcggccacctgcatctctgacacactggggatc
tccctgtcggggctcctggctttgcctctgcatgacttcctctgccagctctcctga

DBGET integrated database retrieval system