KEGG   Homo sapiens (human): 124590Help
Entry
124590            CDS       T01001                                 

Gene name
USH1G, ANKS4A, SANS
Definition
Usher syndrome 1G (autosomal recessive)
Organism
hsa  Homo sapiens (human)
Disease
H00779  
Usher syndrome (US)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 358 aa AA seqDB search
MAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
RYRRELAERSDTLSFSSLTSSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERR
KQGGEGTFKVSEDGRKSARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDEDSV
SRATLAAEPAHSEVSTDSGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPR
GRLQSSPSLDDDSLGSANSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMED
FAALLRQEKIDLEALMLCSDLDLRSISVPLGPRKKILGAVRRRRQAMERPPALEDTEL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatgaagggccacatggaatgcgtgcgctacctggactccatcgcggccaag
cagagcagcctcaaccccaagctggtgggtaagctgaaggacaaggccttccgcgaggcg
gagcggcgcatccgcgagtgcgccaagctgcagcggaggcaccacgaacgcatggagcgg
cgataccggcgcgagctggccgagcgttccgacaccctcagcttctccagcctcacgtcc
agcaccctgagccgccggctgcagcatctggcgctgggcagccacctgccgtactctcag
gccacgctgcacggcacggccaggggcaagaccaagatgcagaagaagctggagcggcgc
aagcagggcggcgaaggcaccttcaaggtctccgaggatgggcgcaagagcgcccgctcg
ctctcgggcctgcagctgggcagcgacgtgatgttcgtgcgccagggcacctacgccaat
cccaaggagtggggccgagccccgctccgggacatgttcctctcggacgaggacagcgtc
tcccgtgccacgctggcggccgagcctgcccactcggaggtcagcaccgactcaggccac
gactccctgtttacccgccccggcctgggcaccatggtgttccgcagaaattacttgagc
agtgggctgcacggactgggccgcgaggatgggggtctggatggggtgggagcgccgcgg
ggtcggctgcagagctcccccagcctggacgatgacagcctgggcagtgccaacagcctg
caggaccgcagctgtggggaggagctgccctgggatgagctcgatttaggcttggacgag
gacctggagcccgagactagcccgctggagaccttcctggcctctctgcacatggaggac
tttgccgccctcctgcggcaggagaagatcgacctcgaggctttgatgctgtgctctgac
ctcgacctccgcagcatcagcgtcccactggggccccgaaagaagatcttgggggccgtg
aggaggcggcggcaggcgatggagcgcccgccggccctggaggacacagagctataa

DBGET integrated database retrieval system