KEGG   Homo sapiens (human): 1261Help
Entry
1261              CDS       T01001                                 

Gene name
CNGA3, ACHM2, CCNC1, CCNCa, CCNCalpha, CNCG3, CNG3
Definition
cyclic nucleotide gated channel alpha 3
Orthology
K04950  
cyclic nucleotide gated channel alpha 3
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Disease
H00971  
Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    1261 (CNGA3)
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    1261 (CNGA3)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1261 (CNGA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q11.2
AA seq 676 aa AA seqDB search
MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADS
GQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQAN
VGSQEPADRGRRKKTKKKDAIVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSE
YLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVP
TDLAYLKVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNA
CIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEY
LFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVI
RWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKL
RPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGS
KSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR
AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLA
DGEVPGDATKTEDKQQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaacacccaatactcccacccctccaggacccacctcaaggtaaagacc
tcagaccgagatctcaatcgcgctgaaaatggcctcagcagagcccactcgtcaagtgag
gagacatcgtcagtgctgcagccggggatcgccatggagaccagaggactggctgactcc
gggcagggctccttcaccggccaggggatcgccaggctgtcgcgcctcatcttcttgctg
cgcaggtgggctgccaggcatgtgcaccaccaggaccagggaccggactcttttcctgat
cgtttccgtggagccgagcttaaggaggtgtccagccaagaaagcaatgcccaggcaaat
gtgggcagccaggagccagcagacagagggagaaggaagaagacgaaaaagaaggatgcg
atcgtggtggacccgtccagcaacctgtactaccgctggctgaccgccatcgccctgcct
gtcttctataactggtatctgcttatttgcagggcctgtttcgatgagctgcagtccgag
tacctgatgctgtggctggtcctggactactcggcagatgtcctgtatgtcttggatgtg
cttgtacgagctcggacaggttttctcgagcaaggcttaatggtcagtgataccaacagg
ctgtggcagcattacaagacgaccacgcagttcaagctggatgtgttgtccctggtcccc
accgacctggcttacttaaaggtgggcacaaactacccagaagtgaggttcaaccgccta
ctgaagttttcccggctctttgaattctttgaccgcacagagacaaggaccaactacccc
aatatgttcaggattgggaacttggtcttgtacattctcatcatcatccactggaatgcc
tgcatctactttgccatttccaagttcattggttttgggacagactcctgggtctaccca
aacatctcaatcccagagcatgggcgcctctccaggaagtacatttacagtctctactgg
tccaccttgacccttaccaccattggtgagaccccaccccccgtgaaagatgaggagtat
ctctttgtggtcgtagacttcttggtgggtgttctgatttttgccaccattgtgggcaat
gtgggctccatgatctcgaatatgaatgcctcacgggcagagttccaggccaagattgat
tccatcaagcagtacatgcagttccgcaaggtcaccaaggacttggagacgcgggttatc
cggtggtttgactacctgtgggccaacaagaagacggtggatgagaaggaggtgctcaag
agcctcccagacaagctgaaggctgagatcgccatcaacgtgcacctggacacgctgaag
aaggttcgcatcttccaggactgtgaggcagggctgctggtggagctggtgctgaagctg
cgacccactgtgttcagccctggggattatatctgcaagaagggagatattgggaaggag
atgtacatcatcaacgagggcaagctggccgtggtggctgatgatggggtcacccagttc
gtggtcctcagcgatggcagctacttcggggagatcagcattctgaacatcaaggggagc
aagtcggggaaccgcaggacggccaacatccgcagcattggctactcagacctgttctgc
ctctcaaaggacgatctcatggaggccctcaccgagtaccccgaagccaagaaggccctg
gaggagaaaggacggcagatcctgatgaaagacaacctgatcgatgaggagctggccagg
gcgggcgcggaccccaaggaccttgaggagaaagtggagcagctggggtcctccctggac
accctgcagaccaggtttgcacgcctcctggctgagtacaacgccacccagatgaagatg
aagcagcgtctcagccaactggaaagccaggtgaagggtggtggggacaagcccctggct
gatggggaagttcccggggatgctacaaaaacagaggacaaacaacagtga

DBGET integrated database retrieval system