KEGG   Homo sapiens (human): 1282Help
Entry
1282              CDS       T01001                                 

Gene name
COL4A1, BSVD
Definition
collagen, type IV, alpha 1
Orthology
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00579  
Hereditary angiopathy with nephropathy, aneurysms, and muscle cramps (HANAC)
H00839  
Porencephaly
H00877  
Brain small vessel disease with Axenfeld-Rieger anomaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1282 (COL4A1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1282 (COL4A1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    1282 (COL4A1)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1282 (COL4A1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1282 (COL4A1)
   05222 Small cell lung cancer
    1282 (COL4A1)
  Infectious diseases
   05146 Amoebiasis
    1282 (COL4A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1282 (COL4A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   1282 (COL4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 519 aa AA seqDB search
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGI
PGTPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPP
GVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGS
PGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPGP
KGFPGLPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGTSLPGPSGRDGLPGPPGSPG
PPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLICDIDGYRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPLLFQIHK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggctgctgctgctgcccgccgcccttctgctccacgag
gagcacagccgggccgctgcgaagggtggctgtgctggctctggctgtggcaaatgtgac
tgccatggagtgaagggacaaaagggtgaaagaggcctcccggggttacaaggtgtcatt
gggtttcctggaatgcaaggacctgaggggccacagggaccaccaggacaaaagggtgat
actggagaaccaggactacctggaacaaaagggacaagaggacctccgggagcatctggc
taccctggaaacccaggacttcccggaattcctggccaagacggcccgccaggcccccca
ggtattccaggatgcaatggcacaaagggggagagagggccgctcgggcctcctggcttg
cctggtttcgctggaaatcccggaccaccaggcttaccagggatgaagggtgatccaggt
gagatacttggccatgtgcccgggatgctgttgaaaggtgaaagaggatttcccggaatc
ccagggactccaggcccaccaggactgccagggcttcaaggtcctgttgggcctccagga
tttaccggaccaccaggtcccccaggccctcccggccctccaggtgaaaagggacaaatg
ggcttaagttttcaaggaccaaaaggtgacaagggtgaccaaggggtcagtgggcctcca
ggagtaccaggacaagctcaagttcaagaaaaaggagacttcgccaccaagggagaaaag
ggccaaaaaggtgaacctggatttcaggggatgccaggggtcggagagaaaggtgaaccc
ggaaaaccaggacccagaggcaaacccggaaaagatggtgacaaaggggaaaaagggagt
cccggttttcctggtgaacccgggtacccaggactcataggccgccagggcccgcaggga
gaaaagggtgaagcaggtcctcctggcccacctggaattgttataggcacaggacctttg
ggagaaaaaggagagaggggctaccctggaactccggggccaagaggagagccaggccca
aaaggtttcccaggactaccaggccaacccggacctccaggcctccctgtacctgggcag
gctggtgcccctggcttccctggtgaaagaggagaaaaaggtgaccgaggatttcctggt
acatctctgccaggaccaagtggaagagatgggctcccgggtcctcctggttcccctggg
ccccctgggcagcctggctacacaaatggaattgtggaatgtcagcccggacctccaggt
gaccagggtcctcctggaattccagggcagccaggatttataggcgaaattggagagaaa
ggtcaaaaaggagagagttgcctcatctgtgatatagacggatatcgggggcctcccggg
ccacagggacccccgggagaaataggtttcccagggcagccaggggccaagggcgacaga
ggtttgcctggcagagatggtgttgcaggagtgccattgctttttcaaatccataaatga

DBGET integrated database retrieval system