KEGG   Homo sapiens (human): 1282Help
Entry
1282              CDS       T01001                                 

Gene name
COL4A1, HANAC, ICH, POREN1, arresten
Definition
collagen, type IV, alpha 1
Orthology
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H00579  
Hereditary angiopathy with nephropathy, aneurysms, and muscle cramps (HANAC)
H00839  
Porencephaly
H00877  
Brain small vessel disease with Axenfeld-Rieger anomaly
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 1669 aa AA seqDB search
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGI
PGTPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPP
GVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGS
PGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPGP
KGFPGLPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGTSLPGPSGRDGLPGPPGSPG
PPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLICDIDGYRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEFYFDLRLK
GDKGDPGFPGQPGMTGRAGSPGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDT
GPPGPPGYGPAGPIGDKGQAGFPGGPGSPGLPGPKGEPGKIVPLPGPPGAEGLPGSPGFP
GPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDMGPPGTPGRPGFNG
LPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVPGEHGAIGPPGLQGI
RGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPG
PKGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGSPGPVGAPG
LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIG
PIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPG
TPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGE
KGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKGEVGFPGLAGSP
GIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPGLPGLPGPMGPPGLPG
IDGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKG
LPGLQGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQGLPGPK
GQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAV
HSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt NT seq  +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggctgctgctgctgcccgccgcccttctgctccacgag
gagcacagccgggccgctgcgaagggtggctgtgctggctctggctgtggcaaatgtgac
tgccatggagtgaagggacaaaagggtgaaagaggcctcccggggttacaaggtgtcatt
gggtttcctggaatgcaaggacctgaggggccacagggaccaccaggacaaaagggtgat
actggagaaccaggactacctggaacaaaagggacaagaggacctccgggagcatctggc
taccctggaaacccaggacttcccggaattcctggccaagacggcccgccaggcccccca
ggtattccaggatgcaatggcacaaagggggagagagggccgctcgggcctcctggcttg
cctggtttcgctggaaatcccggaccaccaggcttaccagggatgaagggtgatccaggt
gagatacttggccatgtgcccgggatgctgttgaaaggtgaaagaggatttcccggaatc
ccagggactccaggcccaccaggactgccagggcttcaaggtcctgttgggcctccagga
tttaccggaccaccaggtcccccaggccctcccggccctccaggtgaaaagggacaaatg
ggcttaagttttcaaggaccaaaaggtgacaagggtgaccaaggggtcagtgggcctcca
ggagtaccaggacaagctcaagttcaagaaaaaggagacttcgccaccaagggagaaaag
ggccaaaaaggtgaacctggatttcaggggatgccaggggtcggagagaaaggtgaaccc
ggaaaaccaggacccagaggcaaacccggaaaagatggtgacaaaggggaaaaagggagt
cccggttttcctggtgaacccgggtacccaggactcataggccgccagggcccgcaggga
gaaaagggtgaagcaggtcctcctggcccacctggaattgttataggcacaggacctttg
ggagaaaaaggagagaggggctaccctggaactccggggccaagaggagagccaggccca
aaaggtttcccaggactaccaggccaacccggacctccaggcctccctgtacctgggcag
gctggtgcccctggcttccctggtgaaagaggagaaaaaggtgaccgaggatttcctggt
acatctctgccaggaccaagtggaagagatgggctcccgggtcctcctggttcccctggg
ccccctgggcagcctggctacacaaatggaattgtggaatgtcagcccggacctccaggt
gaccagggtcctcctggaattccagggcagccaggatttataggcgaaattggagagaaa
ggtcaaaaaggagagagttgcctcatctgtgatatagacggatatcgggggcctcccggg
ccacagggacccccgggagaaataggtttcccagggcagccaggggccaagggcgacaga
ggtttgcctggcagagatggtgttgcaggagtgccaggccctcaaggtacaccagggctg
ataggccagccaggagccaagggggagcctggtgagttttatttcgacttgcggctcaaa
ggtgacaaaggagacccaggctttccaggacagcccggcatgacagggagagcgggttct
cctggaagagatggccatccgggtcttcctggccccaagggctcgccgggttctgtagga
ttgaaaggagagcgtggcccccctggaggagttggattcccaggcagtcgtggtgacacc
ggcccccctgggcctccaggatatggtcctgctggtcccattggtgacaaaggacaagca
ggctttcctggaggccctggatccccaggcctgccaggtccaaagggtgaaccaggaaaa
attgttcctttaccaggcccccctggagcagaaggactgccggggtccccaggcttccca
ggtccccaaggagaccgaggctttcccggaaccccaggaaggccaggcctgccaggagag
aagggcgctgtgggccagccaggcattggatttccagggccccccggccccaaaggtgtt
gacggcttacctggagacatggggccaccggggactccaggtcgcccgggatttaatggc
ttacctgggaacccaggtgtgcagggccagaagggagagcctggagttggtctaccggga
ctcaaaggtttgccaggtcttcccggcattcctggcacacccggggagaaggggagcatt
ggggtaccaggcgttcctggagaacatggagcgatcggaccccctgggcttcaggggatc
agaggtgaaccgggacctcctggattgccaggctccgtggggtctccaggagttccagga
ataggcccccctggagctaggggtccccctggaggacagggaccaccggggttgtcaggc
cctcctggaataaaaggagagaagggtttccccggattccctggactggacatgccgggc
cctaaaggagataaaggggctcaaggactccctggcataacgggacagtcggggctccct
ggccttcctggacagcagggggctcctgggattcctgggtttccaggttccaagggagaa
atgggcgtcatggggacccccgggcagccgggctcaccaggaccagtgggtgctcctgga
ttaccgggtgaaaaaggggaccatggctttccgggctcctcaggacccaggggagaccct
ggcttgaaaggtgataagggggatgtcggtctccctggcaagcctggctccatggataag
gtggacatgggcagcatgaagggccagaaaggagaccaaggagagaaaggacaaattgga
ccaattggtgagaagggatcccgaggagaccctgggaccccaggagtgcctggaaaggac
gggcaggcaggacagcctgggcagccaggacctaaaggtgatccaggtataagtggaacc
ccaggtgctccaggacttccgggaccaaaaggatctgttggtggaatgggcttgccagga
acacctggagagaaaggtgtgcctggcatccctggcccacaaggttcacctggcttacct
ggagacaaaggtgcaaaaggagagaaagggcaggcaggcccacctggcataggcatccca
gggctgcgaggtgaaaagggagatcaagggatagcgggtttcccaggaagccctggagag
aagggagaaaaaggaagcattgggatcccaggaatgccagggtccccaggccttaaaggg
tctcccgggagtgttggctatccaggaagtcctgggctacctggagaaaaaggtgacaaa
ggcctcccaggattggatggcatccctggtgtcaaaggagaagcaggtcttcctgggact
cctggccccacaggcccagctggccagaaaggggagccaggcagtgatggaatcccgggg
tcagcaggagagaagggtgaaccaggtctaccaggaagaggattcccagggtttccaggg
gccaaaggagacaaaggttcaaagggtgaggtgggtttcccaggattagccgggagccca
ggaattcctggatccaaaggagagcaaggattcatgggtcctccggggccccagggacag
ccggggttaccgggatccccaggccatgccacggaggggcccaaaggagaccgcggacct
cagggccagcctggcctgccaggacttccgggacccatggggcctccagggcttcctggg
attgatggagttaaaggtgacaaaggaaatccaggctggccaggagcacccggtgtccca
gggcccaagggagaccctggattccagggcatgcctggtattggtggctctccaggaatc
acaggctctaagggtgatatggggcctccaggagttccaggatttcaaggtccaaaaggt
cttcctggcctccagggaattaaaggtgatcaaggcgatcaaggcgtcccgggagctaaa
ggtctcccgggtcctcctggccccccaggtccttacgacatcatcaaaggggagcccggg
ctccctggtcctgagggccccccagggctgaaagggcttcagggactgccaggcccgaaa
ggccagcaaggtgttacaggattggtgggtatacctggacctccaggtattcctgggttt
gacggtgcccctggccagaaaggagagatgggacctgccgggcctactggtccaagagga
tttccaggtccaccaggccccgatgggttgccaggatccatggggcccccaggcacccca
tctgttgatcacggcttccttgtgaccaggcatagtcaaacaatagatgacccacagtgt
ccttctgggaccaaaattctttaccacgggtactctttgctctacgtgcaaggcaatgaa
cgggcccatggccaggacttgggcacggccggcagctgcctgcgcaagttcagcacaatg
cccttcctgttctgcaatattaacaacgtgtgcaactttgcatcacgaaatgactactcg
tactggctgtccacccctgagcccatgcccatgtcaatggcacccatcacgggggaaaac
ataagaccatttattagtaggtgtgctgtgtgtgaggcgcctgccatggtgatggccgtg
cacagccagaccattcagatcccaccgtgccccagcgggtggtcctcgctgtggatcggc
tactcttttgtgatgcacaccagcgctggtgcagaaggctctggccaagccctggcgtcc
cccggctcctgcctggaggagtttagaagtgcgccattcatcgagtgtcacggccgtggg
acctgcaattactacgcaaacgcttacagcttttggctcgccaccatagagaggagcgag
atgttcaagaagcctacgccgtccaccttgaaggcaggggagctgcgcacgcacgtcagc
cgctgccaagtctgtatgagaagaacataa

DBGET integrated database retrieval system