KEGG   Homo sapiens (human): 1299Help
Entry
1299              CDS       T01001                                 

Gene name
COL9A3, DJ885L7.4.1, EDM3, IDD, MED
Definition
(RefSeq) collagen type IX alpha 3 chain
  KO
K08131  
collagen, type IX, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Human papillomavirus infection
Disease
H00476  
Multiple epiphyseal dysplasia (MED)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1299 (COL9A3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1299 (COL9A3)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    1299 (COL9A3)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1299 (COL9A3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    1299 (COL9A3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
     1299 (COL9A3)
   VLA-2
     1299 (COL9A3)
   alpha 11 beta 1
     1299 (COL9A3)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   1299 (COL9A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14050(Tbio)
UniProt: 
Position
20q13.33
AA seq 684 aa AA seqDB search
MAGPRACAPLLLLLLLGELLAAAGAQRVGLPGPPGPPGPPGKPGQDGIDGEAGPPGLPGP
PGPKGAPGKPGKPGEAGLPGLPGVDGLTGRDGPPGPKGAPGERGSLGPPGPPGLGGKGLP
GPPGEAGVSGPPGGIGLRGPPGPSGLPGLPGPPGPPGPPGHPGVLPEGATDLQCPSICPP
GPPGPPGMPGFKGPTGYKGEQGEVGKDGEKGDPGPPGPAGLPGSVGLQGPRGLRGLPGPL
GPPGDRGPIGFRGPPGIPGAPGKAGDRGERGPEGFRGPKGDLGRPGPKGTPGVAGPSGEP
GMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGERGRAGELGEA
GPSGEPGVPGDAGMPGERGEAGHRGSAGALGPQGPPGAPGVRGFQGQKGSMGDPGLPGPQ
GLRGDVGDRGPGGAAGPKGDQGIAGSDGLPGDKGELGPSGLVGPKGESGSRGELGPKGTQ
GPNGTSGVQGVPGPPGPLGLQGVPGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQL
AAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGNQGD
RGDKGAAGAGLDGPEGDQGPQGPQGVPGTSKDGQDGAPGEPGPPGDPGLPGAIGAQGTPG
ICDTSACQGAVLGGVGEKSGSRSS
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggccgggccgcgcgcgtgcgccccgctcctgctcctgctcctgctcggggagcttctg
gcggccgccggggcgcagagagtgggactccccggcccccccggccccccagggccgccc
gggaagcccggccaggacggcattgacggagaagctggtcctccaggtctgcctgggccc
ccgggaccaaagggggccccaggaaagccggggaaaccaggagaggctgggctgccggga
ctgccgggtgtggatggtctgactggacgagatggaccccctggacccaagggtgcccct
ggggaacggggaagtctgggacccccggggccgcccgggctggggggcaaaggcctccct
ggaccccccggagaggcaggagtgagcggccccccaggtgggatcggcctccgcggcccc
ccgggaccttctggactccccggcctccctggtcccccaggacctcccggaccccctgga
cacccaggagtcctccctgaaggcgctactgaccttcagtgcccaagtatctgcccgcca
ggtcccccagggccccctggaatgccagggttcaagggacccactggctacaaaggcgag
cagggggaagtcggcaaggacggcgagaagggtgaccctggcccccctgggcccgccggc
ctcccgggcagcgtggggctgcagggcccccggggattacgaggactgccagggccactc
gggccccctggggaccggggtcccattgggttccgagggccgcctgggatcccaggagcg
cctgggaaagcgggtgaccgaggcgagaggggcccagaagggttccgcggccccaagggt
gacctcggcagacctggtcccaagggaacccccggagtggccgggccaagcggagagccg
ggcatgccgggcaaggacggccagaatggcgtgccaggactcgatggccagaagggagag
gctggtcgcaacggtgctccgggagagaagggccccaacgggctgccgggcctccctgga
cgagcggggtccaaaggcgagaagggagaacggggcagagctggggagctgggtgaggcc
ggcccctctggagagccaggcgtccctggagatgctggcatgcctggggagcgcggtgag
gctggccaccggggctcagcgggggccctcggcccacaaggccctcccggagcccctggt
gtccgaggcttccagggccagaagggcagcatgggagaccccggccttccaggcccccag
ggcctccgaggtgacgtgggcgaccggggtccgggaggtgccgcaggccctaagggagac
cagggtattgcaggttccgacggtcttcctggggataaaggagaactgggtcccagcggc
ctggtcggacccaaaggagagtctggcagtcgaggggagctgggccccaaaggcacccag
ggtcccaacggcaccagcggtgttcagggtgtccccgggccccccggtcctctgggcctg
cagggcgtcccgggtgttcctggcatcacggggaagccgggagttccggggaaggaggcc
agcgagcagcgcatcagggagctgtgtggggggatgatcagcgaacaaattgcacagtta
gccgcgcacctaaggaagcctttggcacccgggtccattggtcggcccggtccagctggc
ccccctgggcccccaggacccccaggctccattggtcaccctggcgctcgaggaccccct
ggataccgcggtcccactggggagctgggagaccccgggcccagaggaaaccagggtgac
agaggagacaaaggcgcggcaggagcagggctggacgggcctgaaggagaccaggggccc
caaggaccccaaggcgtgcccggcaccagcaaggacggccaggacggtgctcccggcgag
cctgggcctcccggagatcctgggcttccaggtgccattggggcccaggggacaccgggg
atctgcgacacctcagcctgccaaggagccgtgttaggaggggtcggggagaaatcaggc
tctcgaagctcataa

DBGET integrated database retrieval system