KEGG   Homo sapiens (human): 132884Help
Entry
132884            CDS       T01001                                 

Gene name
EVC2, LBN, WAD
Definition
(RefSeq) EvC ciliary complex subunit 2
  KO
K19608  
ellis van creveld syndrome protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Hedgehog signaling pathway
Disease
H00503  
EVC-related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    132884 (EVC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.2
AA seq 1308 aa AA seqDB search
MDPSGSRGRPTWVLAGGLLAVALALGGRGCLGASSRPRWRPLGAQPPRDPQVAPRSGPGL
RIPPGRSGAGPESSTQDLPCMIWPKVECCHFKTAVEAPLGMKLDKKMEVFIPLSTSAASS
GPWAHSLFAFIPSWPKKNLFKRESPITHRLYGDISREVQGTSENGVIFQKCALVSGSSEA
QTARIWLLVNNTKTTSSANLSELLLLDSIAGLTIWDSVGNRTSEGFQAFSKKFLQVGDAF
AVSYAATLQAGDLGNGESLKLPAQLTFQSSSRNRTQLKVLFSITAEENVTVLPHHGLHAA
GFFIAFLLSLVLTWAALFLMVRYQCLKGNMLTRHRVWQYESKLEPLPFTSADGVNEDLSL
NDQMIDILSSEDPGSMLQALEELEIATLNRADADLEACRTQISKDIIALLLKNLTSSGHL
SPQVERKMSAVFKKQFLLLENEIQEEYDRKMVALTAECDLETRKKMENQYQREMMAMEEA
EELLKRAGERSAVECSNLLRTLHGLEQEHLRKSLALQQEEDFAKAHRQLAVFQRNELHSI
FFTQIKSAIFKGELKPEAAKMLLQNYSKIQENVEELMDFFQASKRYHLSKRFGHREYLVQ
NLQSSETRVQGLLSTAAAQLTHLIQKHERAGYLDEDQMEMLLERAQTEVFSIKQKLDNDL
KQEKKKLHQKLITKRRRELLQKHREQRREQASVGEAFRTVEDAGQYLHQKRSLMEEHGAT
LEELQERLDQAALDDLRTLTLSLFEKATDELRRLQNSAMTQELLKRGVPWLFLQQILEEH
GKEMAARAEQLEGEERDRDQEGVQSVRQRLKDDAPEAVTEEQAELRRWEHLIFMKLCSSV
FSLSEEELLRMRQEVHGCFAQMDRSLALPKIRARVLLQQFQTAWREAEFVKLDQAVAAPE
LQQQSKVRKSRSKSKSKGELLKKCIEDKIHLCEEQASEDLVEKVRGELLRERVQRMEAQE
GGFAQSLVALQFQKASRVTETLSAYTALLSIQDLLLEELSASEMLTKSACTQILESHSRE
LQELERKLEDQLVQQEAAQQQQALASWQQWVADGPGILNEPGEVDSERQVSTVLHQALSK
SQTLLEQHQQCLREEQQNSVVLEDLLENMEADTFATLCSQELRLASYLARMAMVPGATLR
RLLSVVLPTASQPQLLALLDSATERHVDHAAESDGGAEQADVGRRRKHQSWWQALDGKLR
GDLISRGLEKMLWARKRKQSILKKTCLPLRERMIFSGKGSWPHLSLEPIGELAPVPIVGA
ETIDLLNTGEKLFIFRNPKEPEISLHVPPRKKKNFLNAKKAMRALGMD
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atggacccctcgggctcccgggggcgccccacgtgggtgctggccgggggtctcctggca
gtggccctggcgctggggggccgaggctgtctcggcgccagctcacgtccccgctggcgc
cccctcggcgcgcagccaccccgggatccccaggtggctcctaggtctgggcccggcctg
aggatccctccggggcggagcggggcggggcccgagagcagcacgcaggacttgccctgt
atgatttggcccaaagtggaatgctgtcactttaagactgcagtggaagcaccacttgga
atgaaattggacaagaaaatggaagtcttcatcccactctcaacttctgcagcctctagt
gggccatgggctcattccttatttgcttttataccctcctggcctaagaagaacttattt
aaaagagagtctcctataacacaccgcctgtatggggacatttcaagagaagttcaaggg
acttctgaaaatggagtaatttttcagaaatgtgcactggtgtctgggtcgagtgaagca
cagacagcccgcatatggctgcttgttaacaacaccaagacaacctcgtcagccaacctc
tcggagctgctcttgctggacagcattgctggtctcaccatttgggactctgtgggaaac
aggacctcggaaggattccaggcttttagcaagaagtttctgcaagtgggagatgccttt
gctgtcagctacgcagccacgctccaggctggagacctcgggaacggggagagcctcaag
cttcctgcccaactcacctttcagagctcgtcacggaacagaacacagctgaaagtgctt
ttttccataacagcagaagaaaacgtaacggttctgccgcaccacggcctccacgcagca
gggttcttcattgccttcctcctctcccttgtgctgacctgggctgccctcttcctcatg
gttcgctatcagtgtctgaagggaaacatgctcaccagacatcgggtttggcagtatgag
agcaagctggaacccttgccgttcacctcagctgatggcgtgaatgaggacctttccctt
aacgaccaaatgatagacattctgtcttccgaggaccctgggagcatgcttcaagcctta
gaagagttggagattgcaaccctgaatcgggcagatgcagatctggaggcttgtcgaaca
caaatcagcaaggatatcattgcccttctgctgaaaaatctcaccagcagtggccacctc
tcaccccaagtagagagaaaaatgagtgctgttttcaaaaagcagtttctattgctggaa
aatgaaatacaagaggagtacgatcggaagatggtggcattgacagctgaatgtgacctg
gaaacaagaaagaagatggaaaaccagtaccagagagagatgatggcaatggaggaagca
gaagagttgctgaaacgtgctggtgagaggtctgctgtagagtgcagcaaccttctgcgg
accctccatggcctggaacaggagcacttgaggaagtctctcgctttgcaacaagaagaa
gactttgccaaagctcacagacagctggctgttttccagagaaatgaactgcacagtatc
ttttttacccagataaaaagtgctattttcaaaggggaattgaaaccagaggcagctaaa
atgctgctgcaaaattattctaaaatacaggagaatgtagaagagttaatggactttttc
caggctagtaagaggtatcatctaagtaaaagatttggccacagggaatatctggtccag
aacctccagtcatcagagacccgtgtgcagggccttctgagcaccgctgcagcccagctg
actcacctcattcagaagcacgagagagcagggtacctggatgaagaccaaatggaaatg
ctattggagcgggctcagacagaagtcttttcaatcaagcagaagttggacaatgactta
aagcaggaaaagaaaaagctccaccaaaaattaataactaagagaagacgagagttgcta
caaaagcacagggagcagcgtagggagcaggcgtccgtcggcgaggccttccgaacggtt
gaggatgccggccagtacctgcaccagaagaggagcctgatggaggagcacggtgccacc
ctggaggagctgcaggagcgtctggaccaggccgccctggacgatctcaggaccctgacc
ctttcgctgtttgaaaaggccaccgacgagctgcggcgcctgcagaactcagccatgacc
caggagctgctcaagcgtggggtgccctggctcttcctgcagcagatcctggaggagcac
ggcaaggagatggctgcacgggccgagcagctggagggggaggagagggacagggaccag
gagggtgtccagagcgtgaggcagagactgaaggatgacgctcctgaggccgtgacagag
gagcaggcagagctgcgacgctgggagcacctgatcttcatgaagctctgctcctcagtc
ttctccctgtctgaagaggagctgctcaggatgaggcaggaggtccatggctgctttgct
cagatggacaggagcttggccctccccaagatccgggcccgagttctgctgcagcaattt
cagactgcgtggcgagaagcagagttcgtgaagctggaccaggccgtggctgcccctgag
ctgcagcaacagtccaaggtgagaaagtcacggtccaagagtaaaagcaagggagagctt
ctgaagaagtgcatcgaagacaaaattcacctctgtgaggaacaggcctctgaagacctg
gtggaaaaggttcgaggtgaattgctgcgggagagagtgcagcggatggaggcacaggag
ggaggctttgcacagtcgcttgttgctctgcagttccagaaggcgtcccgggtgaccgag
actctgtcggcctacaccgccctcctcagcatccaggacttgctcctggaagagctgagt
gcatctgagatgctgaccaagtcggcctgcacacagatcctggagtcgcacagccgggag
ctccaggagttggagaggaagctggaggaccagctggtgcagcaggaggcagcccagcag
cagcaggccctggcgagctggcagcagtgggtggccgatgggcccgggattctgaacgaa
cctggggaggtggattctgaaaggcaggtctctactgtcctgcaccaagccctgagcaag
agccagacattactggagcaacatcagcagtgtttgagagaggaacaacagaacagtgtc
gtgctagaagacttgttggaaaacatggaggcagacacctttgcaaccctgtgcagccag
gagctgagactggcatcgtacctggcgaggatggccatggtgcccggggccacgcttcgc
cggctcctgagtgtggtactgcccacagcctcacagcctcagctgctggccctgctggat
tcggccaccgagagacatgtggaccacgcagctgagagcgatggcggagcggagcaggcc
gacgtgggcaggcggaggaaacaccagagctggtggcaagccttagatggcaaactgcga
ggagatctgataagcagaggattagaaaagatgctgtgggcccgcaagagaaagcagagc
atattaaagaagacatgtctccctctcagagagaggatgatattctctggaaaaggaagt
tggccacacctgtcactggagcccattggcgaactggcccctgtacccattgtaggggca
gaaaccattgatctattaaacacaggagagaagctctttatattcagaaatccaaaggag
ccagagatctcactgcacgttcctcccaggaaaaagaagaactttttgaatgccaaaaag
gccatgagggccttgggcatggactag

DBGET integrated database retrieval system