KEGG   Homo sapiens (human): 1375Help
Entry
1375              CDS       T01001                                 

Gene name
CPT1B, CPT1-M, CPT1M, CPTI, CPTI-M, M-CPT1, MCCPT1, MCPT1
Definition
(RefSeq) carnitine palmitoyltransferase 1B (EC:2.3.1.21)
  KO
K19523  
carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Drug target
Oxfenicine: 
Perhexiline (DG00334): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    1375 (CPT1B)
  Lipid metabolism
   00071 Fatty acid degradation
    1375 (CPT1B)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    1375 (CPT1B)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    1375 (CPT1B)
   04920 Adipocytokine signaling pathway
    1375 (CPT1B)
   03320 PPAR signaling pathway
    1375 (CPT1B)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    1375 (CPT1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     1375 (CPT1B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    1375 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.33
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagctcaccaggccgtggccttccagttcacggtgaccccagacggggtcgac
ttccggctcagtcgggaggccctgaaacacgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcatcatggcaacagtgggttcctccttctgcaacgtggacatctcc
ttggggctggtcagttgcatccagagatgcctccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcgtctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctgctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggctatgtgtatccgccttctatcc
agccggcaccctatgctctacagcttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcgccccttgttggatgatgaggaa
tattaccgcatggagttgctggccaaagaattccaggacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcaagtaactatgtgagtgactggtgggaagag
tacatctaccttcgaggcaggagccctctcatggtgaacagcaactattatgtcatggac
cttgtgctcatcaagaatacagacgtgcaggcagcccgcctgggaaacatcatccacgcc
atgatcatgtatcgccgtaaactggaccgtgaagaaatcaagcctgtgatggcactgggc
atagtgcctatgtgctcctaccagatggagaggatgttcaacaccactcggatcccgggc
aaggacacagatgtgctacagcacctctcagacagccggcacgtggctgtctaccacaag
ggacgcttcttcaagctgtggctctatgagggcgcccgtctgctcaagcctcaggatctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttt
agctctggaaagaataaggctgccttggaggccatcgagcgtgccgctttcttcgtggcc
ctggatgaggaatcctactcctatgaccccgaagatgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactctcatt
tccttcaagaatggccagttgggtctcaatgcagagcatgcgtgggcagatgctcccatc
attgggcacctctgggagtttgtcctgggcacagacagcttccacctgggctacacggag
accgggcactgcctgggcaaaccgaaccctgcgctcgcacctcctacacggctgcagtgg
gacattccaaaacagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgttg
gcagacgacgtggagttgtactgcttccagttcctgccctttggcaaaggcctcatcaag
aagtgccggaccagccctgatgcctttgtgcagatcgcgctgcagctggctcacttccgg
gacaggggtaagttctgcctgacctatgaggcctcaatgaccagaatgttccgggaggga
cggactgagactgtgcgttcctgtaccagcgagtccacagcctttgtgcaggccatgatg
gaggggtcccacacaaaagcagacctgcgagatctcttccagaaggctgctaagaagcac
cagaatatgtaccgcctggccatgaccggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctaggagtcagctctcctttccttgctgaggtgctctcggaa
ccctggcgtctctccaccagccagatcccccaatcccagatccgcatgttcgacccagag
cagcaccccaatcacctgggcgctggaggtggctttggccctgtagcagatgatggctat
ggagtttcctacatgattgcaggcgagaacacgatcttcttccacatctccagcaagttc
tcaagctcagagacgaacgcccagcgctttggaaaccacatccgcaaagccctgctggac
attgctgatcttttccaagttcccaaggcctacagctga

DBGET integrated database retrieval system