KEGG   Homo sapiens (human): 138050Help
Entry
138050            CDS       T01001                                 

Gene name
HGSNAT, HGNAT, MPS3C, TMEM76
Definition
heparan-alpha-glucosaminide N-acetyltransferase (EC:2.3.1.78)
Orthology
K10532  
heparan-alpha-glucosaminide N-acetyltransferase [EC:2.3.1.78]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Module
Heparan sulfate degradation
Disease
H00130  
Mucopolysaccharidosis type III (MPS3)
H00421  
Mucopolysaccharidosis (MPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    138050 (HGSNAT)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    138050 (HGSNAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.78  heparan-alpha-glucosaminide N-acetyltransferase
     138050 (HGSNAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.1
AA seq 635 aa AA seqDB search
MSGAGRALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQALLLIHN
ELLWTNLTVYWKSECCYHCLFQVLVNVPQSPKAGKPSAAAASVSTQHGSILQLNDTLEEK
EVCRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVNEDPVDSNLPVSIAFLIGLAVIIVI
SFLRLLLSLDDFNNWISKAISSRETDRLINSELGSPSRTDPLDGDVQPATWRLSALPPRL
RSVDTFRGIALILMVFVNYGGGKYWYFKHASWNGLTVADLVFPWFVFIMGSSIFLSMTSI
LQRGCSKFRLLGKIAWRSFLLICIGIIIVNPNYCLGPLSWDKVRIPGVLQRLGVTYFVVA
VLELLFAKPVPEHCASERSCLSLRDITSSWPQWLLILVLEGLWLGLTFLLPVPGCPTGYL
GPGGIGDFGKYPNCTGGAAGYIDRLLLGDDHLYQHPSSAVLYHTEVAYDPEGILGTINSI
VMAFLGVQAGKILLYYKARTKDILIRFTAWCCILGLISVALTKVSENEGFIPVNKNLWSL
SYVTTLSSFAFFILLVLYPVVDVKGLWTGTPFFYPGMNSILVYVGHEVFENYFPFQWKLK
DNQSHKEHLTQNIVATALWVLIAYILYRKKIFWKI
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggcgggcagggcgctggccgcgctgctgctggccgcgtccgtgctgagcgcc
gcgctgctggcccccggcggctcttcggggcgcgatgcccaggccgcgccgccacgagac
ttagacaaaaaaagacatgcagagctgaagatggatcaggctttgctactcatccataat
gaacttctctggaccaacttgaccgtctactggaaatctgaatgctgttatcactgcttg
tttcaggttctggtaaacgttcctcagagtccaaaagcagggaagcctagtgctgcagct
gcctctgtcagcacccagcacggatctatcctgcagctgaacgacaccttggaagagaaa
gaagtttgtaggttggaatacagatttggagaatttggaaactattctctcttggtaaag
aacatccataatggagttagtgaaattgcctgtgacctggctgtgaacgaggatccagtt
gatagtaaccttcctgtgagcattgcattccttattggtcttgctgtcatcattgtgata
tcctttctgaggctcttgttgagtttggatgactttaacaattggatttctaaagccata
agttctcgagaaactgatcgcctcatcaattctgagctgggatctcccagcaggacagac
cctctcgatggtgatgttcagccagcaacgtggcgtctatctgccctgccgccccgcctc
cgcagcgtggacaccttcagggggattgctcttatactcatggtctttgtcaattatgga
ggaggaaaatattggtacttcaaacatgcaagttggaatgggctgacagtggctgacctc
gtgttcccgtggtttgtatttattatgggatcttccatttttctatcgatgacttctata
ctgcaacgggggtgttcaaaattcagattgctggggaagattgcatggaggagtttcctg
ttaatctgcataggaattatcattgtgaatcccaattattgccttggtccattgtcttgg
gacaaggtgcgcattcctggtgtgctgcagcgattgggagtgacatactttgtggttgct
gtgttggagctcctctttgctaaacctgtgcctgaacattgtgcctcggagaggagctgc
ctttctcttcgagacatcacgtccagctggccccagtggctgctcatcctggtgctggaa
ggcctgtggctgggcttgacattcctcctgccagtccctgggtgccctactggttatctt
ggtcctgggggcattggagattttggcaagtatccaaattgcactggaggagctgcaggc
tacatcgaccgcctgctgctgggagacgatcacctttaccagcacccatcttctgctgta
ctttaccacaccgaggtggcctatgaccccgagggcatcctgggcaccatcaactccatc
gtgatggcctttttaggagttcaggcaggaaaaatactattgtattacaaggctcggacc
aaagacatcctgattcgattcactgcttggtgttgtattcttgggctcatttctgttgct
ctgacgaaggtttctgaaaatgaaggctttattccagtaaacaaaaatctctggtccctt
tcgtatgtcactacgctcagttcttttgccttcttcatcctgctggtcctgtacccagtt
gtggatgtgaaggggctgtggacaggaaccccattcttttatccaggaatgaattccatt
ctggtatatgtcggccacgaggtgtttgagaactacttcccctttcagtggaagctgaag
gacaaccagtcccacaaggagcacctgactcagaacatcgtcgccactgccctctgggtg
ctcattgcctacatcctctatagaaagaagattttttggaaaatctga

DBGET integrated database retrieval system