KEGG   Homo sapiens (human): 1400Help
Entry
1400              CDS       T01001                                 

Gene name
CRMP1, CRMP-1, DPYSL1, DRP-1, DRP1, ULIP-3
Definition
(RefSeq) collapsin response mediator protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16.1
AA seq 572 aa AA seqDB search
MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEA
NGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSF
EKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQ
LYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAI
TIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAA
FVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEE
RMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI
TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQ
RVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS
LSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtaccagggcaagaagagcatcccgcacatcacgagtgaccgactcctcatcaaa
ggtggacggatcatcaacgatgaccaatccctttatgctgacgtctacctggaggatgga
cttatcaaacaaataggagagaacttaatcgttcctggtggagtgaagaccattgaagcc
aacgggcggatggttattcccggaggtattgatgtcaacacgtacctgcagaagccctcc
caggggatgactgcggctgatgacttcttccaagggaccagggcggcactggtgggcggg
accacgatgatcattgaccatgttgttcctgaacctgggtccagcctactgacctctttc
gagaagtggcacgaagcagctgacaccaaatcctgctgtgattactccctccacgtggac
atcacaagctggtacgatggcgttcgggaggagctggaggtgctggtgcaggacaaaggc
gtcaattccttccaagtctacatggcctataaggatgtctaccaaatgtccgacagccag
ctctatgaagcctttaccttccttaagggcctgggagctgtgatcttggtccatgcagaa
aatggagatttgatagctcaggaacaaaagcggatcctggagatgggcatcacgggtccc
gagggccatgccctgagcagacctgaagagctggaggccgaggcggtgttccgggccatc
accattgcgggccggatcaactgccctgtgtacatcaccaaggtcatgagcaagagtgca
gccgacatcatcgctctggccaggaagaaagggcccctagtttttggagagcccattgcc
gccagcctggggaccgatggcacccattactggagcaagaactgggccaaggctgcggcg
ttcgtgacttcccctcccctgagcccggaccctaccacgcccgactacttgacctcccta
ctggcctgtggggacttgcaggtcacaggcagcggccactgtccctacagcactgcccag
aaggcggtgggcaaggacaactttaccctgatccccgagggtgtcaacgggatagaggag
cggatgacggtcgtctgggacaaggcggtggctactggcaaaatggatgagaaccagttt
gtcgctgtcaccagcaccaatgcagccaagatctttaacctgtacccaaggaaagggcgg
attgccgtgggctcggatgccgacgtggtcatctgggaccccgacaagttgaagaccata
acagccaaaagtcacaagtcggcggtggagtacaacatcttcgagggtatggagtgccac
ggctccccactagtggtcatcagccagggcaagatcgtctttgaagacggaaacatcaac
gtcaacaagggcatgggccgcttcattccgcggaaggcgttcccggagcacctgtaccag
cgcgtcaaaatcaggaataaggtttttggattgcaaggggtttccaggggcatgtatgac
ggtcctgtgtacgaggtaccagctacacccaaatatgcaactcccgctccttcagccaaa
tcttcgccttctaaacaccagcccccacccatcagaaacctccaccagtccaacttcagc
ttatcaggtgcccagatagatgacaacaatcccaggcgcaccggccaccgcatcgtggcg
ccccctggtggccgctccaacatcaccagcctcggttga

DBGET integrated database retrieval system