KEGG   Homo sapiens (human): 1436Help
Entry
1436              CDS       T01001                                 

Gene name
CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R
Definition
colony stimulating factor 1 receptor (EC:2.7.10.1)
Orthology
K05090  
macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
Pathways in cancer
Transcriptional misregulation in cancer
Disease
H00028  
Choriocarcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1436 (CSF1R)
   04015 Rap1 signaling pathway
    1436 (CSF1R)
   04151 PI3K-Akt signaling pathway
    1436 (CSF1R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1436 (CSF1R)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1436 (CSF1R)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1436 (CSF1R)
  Development
   04380 Osteoclast differentiation
    1436 (CSF1R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1436 (CSF1R)
   05202 Transcriptional misregulation in cancers
    1436 (CSF1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1436 (CSF1R)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   1436 (CSF1R)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   1436 (CSF1R)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   1436 (CSF1R)
Cellular antigens [BR:hsa04090]
 Proteins
  1436 (CSF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q32
AA seq 972 aa AA seqDB search
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatc
ccagtgatagagcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttg
cgatgtgtgggcaatggcagcgtggaatgggatggccccccatcacctcactggaccctg
tactctgatggctccagcagcatcctcagcaccaacaacgctaccttccaaaacacgggg
acctatcgctgcactgagcctggagaccccctgggaggcagcgccgccatccacctctat
gtcaaagaccctgcccggccctggaacgtgctagcacaggaggtggtcgtgttcgaggac
caggacgcactactgccctgtctgctcacagacccggtgctggaagcaggcgtctcgctg
gtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcat
ggcttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctg
atgggtggcaggaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatccca
gggcccccagccttgacactggtgcctgcagagctggtgcggattcgaggggaggctgcc
cagatcgtgtgctcagccagcagcgttgatgttaactttgatgtcttcctccaacacaac
aacaccaagctcgcaatccctcaacaatctgactttcataataaccgttaccaaaaagtc
ctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactcctgcgtggcc
agcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctac
ttgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaac
ctcaaagtcatggtggaggcctacccaggcctgcaaggttttaactggacctacctggga
cccttttctgaccaccagcctgagcccaagcttgctaatgctaccaccaaggacacatac
aggcacaccttcaccctctctctgccccgcctgaagccctctgaggctggccgctactcc
ttcctggccagaaacccaggaggctggagagctctgacgtttgagctcacccttcgatac
cccccagaggtaagcgtcatatggacattcatcaacggctctggcacccttttgtgtgct
gcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgatagg
tgtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccag
gagcccttccacaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaac
caaacctacgagtgcagggcccacaacagcgtggggagtggctcctgggccttcataccc
atctctgcaggagcccacacgcatcccccggatgagttcctcttcacaccagtggtggtc
gcctgcatgtccatcatggccttgctgctgctgctgctcctgctgctattgtacaagtat
aagcagaagcccaagtaccaggtccgctggaagatcatcgagagctatgagggcaacagt
tatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccggaac
aacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacg
gcctttggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtcc
acggcccatgctgatgagaaggaggccctcatgtccgagctgaagatcatgagccacctg
ggccagcacgagaacatcgtcaaccttctgggagcctgtacccatggaggccctgtactg
gtcatcacggagtactgttgctatggcgacctgctcaactttctgcgaaggaaggctgag
gccatgctgggacccagcctgagccccggccaggaccccgagggaggcgtcgactataag
aacatccacctcgagaagaaatatgtccgcagggacagtggcttctccagccagggtgtg
gacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagcaa
gacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagc
caagtagcccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggca
gcgcgtaacgtgctgttgaccaatggtcatgtggccaagattggggacttcgggctggct
agggacatcatgaatgactccaactacattgtcaagggcaatgcccgcctgcctgtgaag
tggatggccccagagagcatctttgactgtgtctacacggttcagagcgacgtctggtcc
tatggcatcctcctctgggagatcttctcacttgggctgaatccctaccctggcatcctg
gtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt
gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacaga
cccaccttccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagag
cgggactataccaatctgccgagcagcagcagaagcggtggcagcggcagcagcagcagt
gagctggaggaggagagctctagtgagcacctgacctgctgcgagcaaggggatatcgcc
cagcccttgctgcagcccaacaactatcagttctgctga

DBGET integrated database retrieval system