KEGG   Homo sapiens (human): 147912Help
Entry
147912            CDS       T01001                                 

Gene name
SIX5, BOR2, DMAHP
Definition
SIX homeobox 5
Organism
hsa  Homo sapiens (human)
Disease
H00453  
Contiguous gene deletion syndrome involving EYA1
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.32
AA seq 739 aa AA seqDB search
MATLPAEPSAGPAAGGEAVAAAAATEEEEEEARQLLQTLQAAEGEAAAAAGAGAGAAAAG
AEGPGSPGVPGSPPEAASEPPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERL
RGSDPVLRARALVAFQRGEYAELYRLLESRPFPAAHHAFLQDLYLRARYHEAERARGRAL
GAVDKYRLRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGL
SLTQVSNWFKNRRQRDRTGAGGGAPCKSESDGNPTTEDESSRSPEDLERGAAPVSAEAAA
QGSIFLAGTGPPAPCPASSSILVNGSFLAASGSPAVLLNGGPVIINGLALGEASSLGPLL
LTGGGGAPPPQPSPQGASETKTSLVLDPQTGEVRLEEAQSEAPETKGAQVAAPGPALGEE
VLGPLAQVVPGPPTAATFPLPPGPVPAVAAPQVVPLSPPPGYPTGLSPTSPLLNLPQVVP
TSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFL
LANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLPPAPGLALPLKPETAISVPEGGL
PVAPSPALPEAHALGTLSAQQPPPAAATTSSTSLPFSPDSPGLLPNFPAPPPEGLMLSPA
AVPVWSAGLELSAGTEGLLEAEKGLGTQAPHTVLRLPDPDPEGLLLGATAGGEVDEGLEA
EAKVLTQLQSVPVEEPLEL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggctaccttgcctgcggagccgagcgcggggccggcggctgggggggaggcggtggcg
gcggcggcggcgaccgaagaggaggaggaggaagcgcgccagctcttgcagactttgcag
gcggccgagggtgaggcggcggcggcggccggggccggggcgggcgcagcggctgcggga
gctgagggcccgggatccccgggcgtccccgggtcgccccccgaggccgcttccgaaccg
cccacgggcctccgcttctcgcccgagcaggtggcgtgcgtctgcgaggcgctgctccag
gcgggccacgccggccgcttgagccgcttcctgggcgcactgcccccggccgagcgccta
cgtggcagcgacccggtgttgcgcgcgcgggccctggtggccttccagcggggcgagtac
gccgagctctaccggctactcgagagccgccccttccccgccgcccaccacgccttcctg
caggacctctacctgcgcgcgcgctaccatgaggccgagcgggcccgcggccgcgcgctt
ggcgcagtggacaagtatcgactgcgcaagaagttcccgctgcccaagaccatctgggac
ggcgaggagacagtctactgcttcaaggagcgctcccgcgcagcgctcaaggcctgctac
cgcggcaaccgctaccccacgccggacgagaagcgccgcctggccacactcaccggcctg
tcgctcacgcaggtcagcaactggttcaagaaccggcgacagcgcgaccggaccggggcc
ggaggcggcgcgccctgcaagagcgagtctgatgggaatcccacgactgaggacgagtcc
agccgaagtcctgaggacctggagagaggggcggccccagtgtccgccgaggccgctgcc
cagggctccatattcctggcagggaccggccctcccgcgccttgcccggcttcctcctcc
atcctggtgaacgggagcttcctggcagccagcggctccccagcagtgctcctcaacggg
ggccccgtcatcatcaacggcctggccctgggcgaggcctccagcctgggcccgctgctg
ctcactgggggcgggggtgcccctccaccgcagcccagccctcagggggccagcgagacc
aagacctctctggtcctggaccctcagacaggggaggtgcggctggaggaggctcagtcg
gaggcccctgagaccaaaggggcccaggtggctgctccgggaccagcccttggagaggag
gtcctggggcccctggcccaagtggtgcctggccccccgacggctgccacctttcctctg
cccccggggccagtgcctgctgtggctgccccacaagtggtaccgctctccccacccccg
gggtatcccacgggcctgagccccacctccccactattgaacctgccccaggtagtaccc
acctcacaggtggtgaccctgccccaggctgtggggcccctgcagctgttggcagccggg
ccaggcagccctgtgaaggtggcagctgcagcaggccctgccaatgtgcacctcatcaac
tccggggtgggcgtgactgccctgcagctgccttcggccactgccccaggaaacttcctc
ctggccaaccctgtgtctggcagccccatcgtgacgggtgtggccgtgcagcagggcaag
atcatcctcaccgccaccttccccaccagcatgctcgtctcccaggtcctgccgccagcc
cccggcctggccctgccactgaagccagagacggccatctccgtgcctgagggaggcctc
ccggtggcccccagccctgctctcccagaggctcacgccctaggcaccctttctgcacag
cagccaccccccgccgctgccaccacctccagcaccagcctgcccttctcccctgactcc
cctggcctcctgcccaacttcccggcgcccccaccagaggggctgatgttgtcacccgcg
gccgtgcctgtctggtcagcagggctggaactaagcgcaggaacagaggggctgctggaa
gcggaaaaggggctggggacacaggccccccacaccgtgctgaggctgccagaccccgac
cctgaggggctgctcctgggggccaccgcagggggtgaggttgacgaggggttggaagct
gaggccaaggttctgacccagctccagtcggtgcctgtggaggagcccttggaactgtga

DBGET integrated database retrieval system