KEGG   Homo sapiens (human): 1535Help
Entry
1535              CDS       T01001                                 

Gene name
CYBA, p22-PHOX
Definition
(RefSeq) cytochrome b-245 alpha chain
  KO
K08009  
cytochrome b-245, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
NOD-like receptor signaling pathway
Leukocyte transendothelial migration
Leishmaniasis
Fluid shear stress and atherosclerosis
Disease
H00098  
Chronic granulomatous disease
H01167  
Gluconobacter infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1535 (CYBA)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    1535 (CYBA)
   04670 Leukocyte transendothelial migration
    1535 (CYBA)
  Development
   04380 Osteoclast differentiation
    1535 (CYBA)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1535 (CYBA)
  Infectious diseases
   05140 Leishmaniasis
    1535 (CYBA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    1535 (CYBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P13498(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16q24.2
AA seq 195 aa AA seqDB search
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRK
KGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGI
YLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPP
GGPQVNPIPVTDEVV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggcctgatc
ctcatcaccgggggcatcgtggccacagctgggcgcttcacccagtggtactttggtgcc
tactccattgtggcgggcgtgtttgtgtgcctgctggagtacccccgggggaagaggaag
aagggctccaccatggagcgctggggacagaagtacatgaccgccgtggtgaagctgttc
gggccctttaccaggaattactatgttcgggccgtcctgcatctcctgctctcggtgccc
gccggcttcctgctggccaccatccttgggaccgcctgcctggccattgcgagcggcatc
tacctactggcggctgtgcgtggcgagcagtggacgcccatcgagcccaagccccgggag
cggccgcagatcggaggcaccatcaagcagccgcccagcaaccccccgccgcggcccccg
gccgaggcccgcaagaagcccagcgaggaggaggctgcggtggcggcggggggacccccg
ggaggtccccaggtcaaccccatcccggtgaccgacgaggtcgtgtga

DBGET integrated database retrieval system