KEGG   Homo sapiens (human): 157680Help
Entry
157680            CDS       T01001                                 

Gene name
VPS13B, CHS1, COH1
Definition
(RefSeq) vacuolar protein sorting 13 homolog B
  KO
K19526  
vacuolar protein sorting-associated protein 13B
Organism
hsa  Homo sapiens (human)
Disease
H00940  
Cohen syndrome
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q22.2
AA seq 4022 aa AA seqDB search
MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSG
HIHELRIHVPWTKLGSEPVVITINTMECILKLKDGIQDDHESCGSNSTNRSTAESTKSSI
KPRRMQQAAPTDPDLPPGYVQSLIRRVVNNVNIVINNLILKYVEDDIVLSVNITSAECYT
VGELWDRAFMDISATDLVLRKVINFSDCTVCLDKRNASGKIEFYQDPLLYKCSFRTRLHF
TYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDL
TCHNKDMLGNITGSEDETRIDMQYPAQHKGQELYSQQDEEQPQGWVSWAWSFVPAIVSYD
DGEEDFVGNDPASTMHQQKAQTLKDPIVSIGFYCTKATVTFKLTEMQVESSYYSPQKVKS
KEVLCWEQEGTTVEALMMGEPFFDCQIGFVGCRAMCLKGIMGVKDFEENMNRSETEACFF
ICGDNLSTKGFTYLTNSLFDYRSPENNGTRAEFILDSTHHKETYTEIAGMQRFGAFYMDY
LYTMENTSGKGSTNQQDFSSGKSEDLGTVQEKSTKSLVIGPLDFRLDSSAVHRILKMIVC
ALEHEYEPYSRLKSDIKDENETILNPEEVALLEEYIPTRHTSVTLLKCTCTISMAEFNLL
DHLLPVIMGEKNSSNFMNTTNFQSLRPLPSIRILVDKINLEHSVPMYAEQLVHVVSSLTQ
PSDNLLHYCYVHCYLKIFGFQAGLTSLDCSGSYCLPVPVIPSFSTALYGKLLKLPTCWTK
RSQIAITEGIFELPNLTIQATRAQTLLLQAIYQSWSHLGNVSSSAVIEALINEIFLSIGV
KSKNPLPTLEGSIQNVELKYCSTSLVKCASGTMGSIKICAKAPVDSGKEKLIPLLQGPSD
TKDLHSTKWLNESRKPESLLAPDLMAFTIQVPQYIDYCHNSGAVLLCSIQGLAVNIDPIL
YTWLIYQPQKRTSRHMQQQPVVAVPLVMPVCRRKEDEVSIGSAPLAKQQSYQASEYASSP
VKTKTVTESRPLSVPVKAMLNISESCRSPEERMKEFIGIVWNAVKHLTLQLEVQSCCVFI
PNDSLPSPSTIVSGDIPGTVRSWYHGQTSMPGTLVLCLPQIKIISAGHKYMEPLQEIPFV
IPRPILEEGDAFPWTISLHNFSIYTLLGKQVTLCLVEPMGCTSTLAVTSQKLLATGPDTR
HSFVVCLHVDLESLEIKCSNPQVQLFYELTDIMNKVWNKIQKRGNLNLSPTSPETMAGPV
PTSPVRSSIGTAPPDTSTCSPSADIGTTTEGDSIQAGEESPFSDSVTLEQTTSNIGGTSG
RVSLWMQWVLPKITIKLFAPDPENKGTEVCMVSELEDLSASIDVQDVYTKVKCKIESFNI
DHYRSSLGEECWSLGQCGGVFLSCTDKLNRRTLLVRPISKQDPFSNCSGFFPSTTTKLLD
GTHQQHGFLSLTYTKAVTKNVRHKLTSRNERRSFHKLSEGLMDGSPHFLHEILLSAQAFD
IVLYFPLLNAIASIFQAKLPKTQKEKRKSPGQPMRTHTLTSRNLPLIYVNTSVIRIFIPK
TEEMQPTVEANQAAKEDTVVLKIGSVAMAPQADNPLGRSVLRKDIYQRALNLGILRDPGS
EIEDRQYQIDLQSINIGTAQWHQLKPEKESVSGGVVTETERNSQNPALEWNMASSIRRHQ
ERRAILTPVLTDFSVRITGAPAVIFTKVVSPENLHTEEILVCGHSLEVNITTNLDFFLSV
AQVQLLHQLIVANMTGLEPSNKAAEISKQEQKKVDIFDGGMAETSSRYSGAQDSGIGSDS
VKIRIVQIEQHSGASQHRIARPSRQSSIVKNLNFIPFDIFITASRISLMTYSCMALSKSK
SQEQKNNEKTDKSSLNLPEVDSDVAKPNQACISTVTAEDLLRSSISFPSGKKIGVLSLES
LHASTRSSARQALGITIVRQPGRRGTGDLQLEPFLYFIVSQPSLLLSCHHRKQRVEVSIF
DAVLKGVASDYKCIDPGKTLPEALDYCTVWLQTVPGEIDSKSGIPPSFITLQIKDFLNGP
ADVNLDISKPLKANLSFTKLDQINLFLKKIKNAHSLAHSEETSAMSNTMVNKDDLPVSKY
YRGKLSKPKIHGDGVQKISAQENMWRAVSCFQKISVQTTQIVISMETVPHTSKPCLLASL
SNLNGSLSVKATQKVPGIILGSSFLLSINDFLLKTSLKERSRILIGPCCATANLEAKWCK
HSGNPGPEQSIPKISIDLRGGLLQVFWGQEHLNCLVLLHELLNGYLNEEGNFEVQVSEPV
PQMSSPVEKNQTFKSEQSSDDLRTGLFQYVQDAESLKLPGVYEVLFYNETEDCPGMMLWR
YPEPRVLTLVRITPVPFNTTEDPDISTADLGDVLQVPCSLEYWDELQKVFVAFREFNLSE
SKVCELQLPDINLVNDQKKLVSSDLWRIVLNSSQNGADDQSSASESGSQSTCDPLVTPTA
LAACTRVDSCFTPWFVPSLCVSFQFAHLEFHLCHHLDQLGTAAPQYLQPFVSDRNMPSEL
EYMIVSFREPHMYLRQWNNGSVCQEIQFLAQADCKLLECRNVTMQSVVKPFSIFGQMAVS
SDVVEKLLDCTVIVDSVFVNLGQHVVHSLNTAIQAWQQNKCPEVEELVFSHFVICNDTQE
TLRFGQVDTDENILLASLHSHQYSWRSHKSPQLLHICIEGWGNWRWSEPFSVDHAGTFIR
TIQYRGRTASLIIKVQQLNGVQKQIIICGRQIICSYLSQSIELKVVQHYIGQDGQAVVRE
HFDCLTAKQKLPSYILENNELTELCVKAKGDEDWSRDVCLESKAPEYSIVIQVPSSNSSI
IYVWCTVLTLEPNSQVQQRMIVFSPLFIMRSHLPDPIIIHLEKRSLGLSETQIIPGKGQE
KPLQNIEPDLVHHLTFQAREEYDPSDCAVPISTSLIKQIATKVHPGGTVNQILDEFYGPE
KSLQPIWPYNKKDSDRNEQLSQWDSPMRVKLSIWKPYVRTLLIELLPWALLINESKWDLW
LFEGEKIVLQVPAGKIIIPPNFQEAFQIGIYWANTNTVHKSVAIKLVHNLTSPKWKDGGN
GEVVTLDEEAFVDTEIRLGAFPGHQKLCQFCISSMVQQGIQIIQIEDKTTIINNTPYQIF
YKPQLSVCNPHSGKEYFRVPDSATFSICPGGEQPAMKSSSLPCWDLMPDISQSVLDASLL
QKQIMLGFSPAPGADSSQCWSLPAIVRPEFPRQSVAVPLGNFRENGFCTRAIVLTYQEHL
GVTYLTLSEDPSPRVIIHNRCPVKMLIKENIKDIPKFEVYCKKIPSECSIHHELYHQISS
YPDCKTKDLLPSLLLRVEPLDEVTTEWSDAIDINSQGTQVVFLTGFGYVYVDVVHQCGTV
FITVAPEGKAGPILTNTNRAPEKIVTFKMFITQLSLAVFDDLTHHKASAELLRLTLDNIF
LCVAPGAGPLPGEEPVAALFELYCVEICCGDLQLDNQLYNKSNFHFAVLVCQGEKAEPIQ
CSKMQSLLISNKELEEYKEKCFIKLCITLNEGKSILCDINEFSFELKPARLYVEDTFVYY
IKTLFDTYLPNSRLAGHSTHLSGGKQVLPMQVTQHARALVNPVKLRKLVIQPVNLLVSIH
ASLKLYIASDHTPLSFSVFERGPIFTTARQLVHALAMHYAAGALFRAGWVVGSLDILGSP
ASLVRSIGNGVADFFRLPYEGLTRGPGAFVSGVSRGTTSFVKHISKGTLTSITNLATSLA
RNMDRLSLDEEHYNRQEEWRRQLPESLGEGLRQGLSRLGISLLGAIAGIVDQPMQNFQKT
SEAQASAGHKAKGVISGVGKGIMGVFTKPIGGAAELVSQTGYGILHGAGLSQLPKQRHQP
SDLHADQAPNSHVKYVWKMLQSLGRPEVHMALDVVLVRGSGQEHEGCLLLTSEVLFVVSV
SEDTQQQAFPVTEIDCAQDSKQNNLLTVQLKQPRVACDVEVDGVRERLSEQQYNRLVDYI
TKTSCHLAPSCSSMQIPCPVVAAEPPPSTVKTYHYLVDPHFAQVFLSKFTMVKNKALRKG
FP
NT seq 12069 nt NT seq  +upstreamnt  +downstreamnt
atgctggagtcatatgtaactccaattttaatgagctatgtgaatcgctacatcaagaac
ttaaagccgtcggatctacagctttcactatggggtggagacgtggtactcagcaagctc
gagttaaagttggatgtgctggaacaggaactgaaattaccattcacttttttaagtgga
catattcatgaattgaggattcatgtaccatggacaaaactgggttcagaaccagtggta
attaccatcaatactatggaatgcattttgaaacttaaggatgggatacaggatgaccat
gaaagctgtggttctaattctaccaaccgtagtactgctgagagcacaaaatcatcaatc
aaaccgcggagaatgcagcaggctgctcctacagatcctgacttaccaccaggttatgtg
cagagtctgattagacgagttgtaaataatgtaaacattgtgataaataatctcatacta
aaatatgttgaagatgatatcgtcctttccgtcaatatcacttctgcagaatgttataca
gtaggtgaattatgggatcgtgcattcatggatatttctgcaactgatttggtgctgaga
aaggttatcaatttttctgactgtacagtttgtcttgataaacggaatgccagtggtaaa
atagaattttaccaggatcctttattatacaaatgttccttcagaactcgtcttcatttt
acatatgaaaacctaaattccaagatgccatctgttattaaaattcatactttagtggaa
agtttgaaactttctatcacagatcaacaactgcctatgtttattcgtataatgcaactt
ggaattgctctttactatggagaaataggcaattttaaagaaggcgaaatagaggacctt
acttgtcataataaagatatgctaggaaacattacaggttctgaagatgaaacaagaata
gatatgcaatatcctgctcagcataaaggtcaagagttatattcacagcaagatgaggag
cagccacagggatgggtgtcatgggcctggtcctttgtgcctgcaattgtgagttatgac
gatggcgaggaagactttgttgggaacgatcctgcatcaaccatgcatcaacaaaaagca
cagactttgaaggatcctattgtttctataggattttattgcacaaaggcaacggtgact
ttcaaactcacagaaatgcaagttgagagtagttattacagtccacagaaagtaaaatct
aaagaagtattgtgttgggaacaagaaggaactacagttgaggcccttatgatgggagaa
cctttctttgattgccagattgggtttgttggttgcagagccatgtgccttaaaggaatt
atgggtgttaaagattttgaagagaatatgaatagaagtgaaactgaagcctgtttcttc
atttgtggtgacaatttgagtacgaaaggtttcacataccttacaaattcattgtttgat
taccgaagcccagaaaataatggtactcgcgcagaatttatcttggattcaactcatcat
aaggagacatacactgagatagctggaatgcaacggtttggggctttttatatggattac
ctgtatacaatggagaacactagtggcaaaggttccacaaatcaacaagacttttcttca
gggaaaagtgaagatttgggaacagttcaggagaagtccaccaaaagccttgttataggt
cctcttgattttcgtttggatagcagtgcggtgcataggattttgaaaatgattgtgtgt
gccttggaacatgaatatgaaccatatagcaggctaaaatcagatattaaggatgaaaat
gaaacaatactgaatcctgaagaggtggctcttctggaggaatatattcctactcgacat
acaagtgttactctcctcaaatgtacctgcacaatttccatggctgaattcaacttgctg
gaccatttactacctgtcattatgggagaaaagaactcaagtaacttcatgaatactaca
aacttccagtctcttcggcctttgccatccattcgaatattggtggataaaattaatctg
gaacattcagtgccaatgtatgctgaacagttggtgcatgtggtcagcagccttactcaa
ccttctgataacctgcttcattattgttatgtacactgctatcttaagatatttggtttc
caggcaggactgacgtctttggattgcagtggatcttactgcttacctgtaccagttatt
ccctctttcagcactgctctttatgggaaacttctgaaactccccacatgctggaccaaa
agatctcagattgctataactgaaggtatatttgaacttccaaatctcacaattcaagct
acaagagcacagacacttctcttgcaagcaatatatcaaagttggtctcatcttggaaat
gtcagctcttccgcagtgattgaagctttgataaatgaaatcttcctaagtataggtgtg
aaatctaagaatcccctgccaactcttgagggctcaatccagaatgttgaattgaagtac
tgcagcacatcattggtcaaatgtgcctctgggaccatgggatcaataaaaatttgtgcc
aaagccccagttgatagtggaaaagagaagttgattcccttgcttcagggtccttctgac
actaaagaccttcatagcaccaagtggctcaatgagagtagaaagccagagtctctctta
gctccagatttgatggccttcacaatccaagttccacaatatattgactactgccacaat
tccggtgctgtacttctttgcagtatacaaggactagcagttaatattgacccaatctta
tatacgtggctcatctatcagcctcagaaacgaacaagtagacatatgcaacagcagcct
gtggtagctgttcctcttgttatgccagtttgtagaaggaaagaggatgaggtgtctatt
ggaagtgcccccttggcaaagcagcaatcatatcaggcctctgaatatgccagcagccct
gtaaaaacaaaaacggtaacagaatcccgcccattgtcagttcctgttaaagccatgttg
aatatatctgaaagctgtagaagtcctgaagaaagaatgaaggaatttattggaattgtt
tggaatgcagtgaagcatctcacactacagcttgaagtacaatcttgttgtgtgtttatt
ccaaatgatagcctgccttccccaagtacaattgtatctggtgacattcctggaacagta
agaagttggtaccatggacaaaccagcatgccgggaacacttgtcctctgtttgcctcaa
ataaagattattagtgctgggcacaagtatatggaacctctgcaggagattccatttgtt
atcccacgacccatccttgaagaaggtgatgcttttccttggacgatcagcttgcataat
ttcagcatatatacccttcttggaaaacaagtgacactttgcctagtggaacctatgggt
tgcacctccactctagctgtcacgtctcaaaaactgcttgctacgggacctgatacacga
cattcatttgttgtctgtctccatgttgacctagagtcactagagataaaatgctctaat
ccccaggtccagctcttctatgaactaactgatatcatgaataaggtctggaacaagatt
cagaagagaggcaatctcaacctatctccaacctctccagagaccatggcagggcctgtt
cctacttctccagttagaagcagtataggcacagctcctccagataccagcacatgcagc
ccatctgctgacattgggactactactgagggagattctatacaagcaggtgaggaatca
ccattctcagattctgtgaccttggaacaaactacaagtaatattggaggaaccagtgga
cgtgttagtttatggatgcagtgggtgcttcccaaaattactataaagctctttgctcca
gatcctgaaaataaaggcacagaggtttgtatggtcagtgaactagaagatctcagtgct
tccatagatgtccaggatgtatataccaaagtgaaatgtaaaatagagagtttcaatatt
gatcactatagaagcagccttggggaagagtgttggtctttggggcaatgtggaggtgtc
ttcctttcctgtactgacaagctgaacagacgcaccttgttggttcgacccatcagcaag
caggaccctttcagtaattgctctggcttctttccttctacaactacaaaacttctagat
ggcactcatcagcagcatggattcctctctctgacatacacaaaagctgtaacaaaaaat
gtccgccacaagttaacatcaagaaatgagcgaagaagttttcataagttatctgaaggc
ctaatggatggttctcctcattttcttcatgaaattcttctttcagcacaagcttttgat
attgttctttattttcctttacttaatgccattgcaagtatatttcaagcaaaactacca
aagacccaaaaagagaaaagaaaatctcctggtcagcccatgaggacccatacactgaca
tcccgcaatttacctttgatttatgtcaacacaagtgtaatcagaatttttattccaaaa
acagaagaaatgcagccaactgttgaagctaatcaggcagcaaaagaagacactgtggtt
ttgaagattggctctgttgccatggctccccaggctgacaatccccttggcagatctgtc
cttaggaaagatatttaccagagagccttgaacttaggaattcttcgagatcctggatca
gaaatcgaagacagacaataccaaatagatctgcagtccatcaatattggtactgcacag
tggcatcaactaaaaccagagaaggaaagtgtctcaggaggggtggtaacagagactgaa
aggaattctcaaaatccagcccttgagtggaatatggccagcagcatacggcggcatcaa
gaaaggagagcaattttgacccccgttttgacagatttttctgtccgaataactggagca
cctgctgtcattttcaccaaagtagtttctccagaaaatttgcatactgaggagatttta
gtgtgtggccattccttagaagtgaatataaccacaaacctggacttcttcctaagtgtg
gctcaagttcaactcttacatcagttaatagtagcaaatatgactggactggaaccatca
aacaaggctgcagagatctctaaacaagaacagaaaaaagtggatatatttgatggaggc
atggctgaaacctcatctcgctacagtggtgctcaggatagtggaattggcagtgacagt
gttaaaatcagaatagtgcaaatagagcagcacagtggtgccagtcagcatcgcattgcc
cgtccctcacgccagtcatcaattgtaaaaaatctaaattttattccctttgacatattt
attactgcaagtagaatctcactaatgacctattcctgtatggccttatccaaatcgaaa
tcacaagaacagaagaataatgaaaaaacagacaagagttcattaaatctcccagaagtt
gattcagatgttgctaagcccaaccaggcatgtatttccacggtgacagcagaagatctc
ttaaggagcagcatttcttttccttcagggaaaaaaataggggtcctctctcttgaaagt
cttcatgcatccacaaggtcatctgctagacaagcacttggtataactattgttcggcag
cctggtcgaagaggaactggtgacttacagctagagccttttctgtactttattgtgtcc
cagccttccttgcttctgagttgtcaccacagaaagcagcgagtggaagtatccattttt
gatgctgtgcttaaaggggtggcctctgattacaaatgtatagatcctgggaagactctg
cctgaagcccttgattattgcactgtttggctacagacagtgcctggagaaatagacagc
aaaagtggtattccaccttcctttataacactacagattaaagactttctgaatggacca
gcggatgtcaatttggatatatcaaagcctttgaaagcaaacctgagtttcaccaaactg
gatcagataaacctttttttaaagaagataaaaaatgcacacagtttggcacatagtgaa
gagacttcagccatgtccaacaccatggtgaataaggatgatcttccagtctccaaatat
taccgtggaaagttgtctaaacccaaaattcatggtgatggagtgcaaaagatttcagct
caagaaaacatgtggagagctgtttcctgctttcaaaaaatttctgttcaaactactcag
attgtgatctccatggaaactgtaccccataccagcaaaccatgcctgttagcatctctc
tcaaacctcaatggaagccttagtgtcaaggcaacacaaaaagtacctggcataattctt
gggtcatcatttctactcagtataaacgattttctccttaaaacaagtctcaaagaaaga
agccgcattctgataggaccatgttgtgctactgccaatctggaagctaagtggtgtaaa
cacagcgggaatccaggcccagaacaatccataccaaaaatatccattgacttaagagga
ggtctactacaggtcttctggggtcaagaacatttgaattgtttagttcttctacatgaa
ttactcaatggataccttaatgaggagggaaattttgaagtacaagtttctgaaccagtg
cctcaaatgtcatctcctgtggaaaagaatcagacatttaaaagtgaacaaagttcagat
gacctacggacaggtctatttcagtatgtacaggatgctgaatctttgaaattgcctggg
gtctatgaagtcttattttataatgaaactgaagattgcccagggatgatgttatggaga
tatccagaacctagagtactcacccttgtacgaataactcctgtaccttttaacaccaca
gaggatccagatattagcacagcagaccttggtgatgtgctacaggttccttgtagcttg
gaatactgggatgaactccagaaggtttttgttgcatttagagaatttaatctgtctgaa
agcaaagtttgtgaactgcagttgccggatatcaatctcgtgaatgaccagaagaaatta
gtatcttcagatctttggagaattgtcttgaacagcagtcaaaatggagctgatgaccaa
agctctgcaagtgagtctggttctcaaagcacttgtgatccacttgtgactccaacagcc
ctggctgcctgtaccagagttgactcctgctttaccccatggtttgtcccatccctttgc
gtttctttccagtttgctcacctggaattccatctttgtcatcaccttgaccaactaggc
acagctgcaccacagtacctacagccatttgtttccgacagaaatatgccatctgaacta
gaatacatgattgtttccttcagagaaccacacatgtatcttcgacagtggaataatggt
tctgtctgtcaggagatccagttcttagctcaagcagactgtaaacttctagagtgcaga
aatgtcactatgcaaagtgtggtgaaacccttcagcatcttcgggcagatggcagtttcc
agcgatgtagtggaaaagctgcttgactgcaccgtgatagttgattctgtatttgtaaac
cttggacagcatgtagtccattcactaaacactgcaatacaagcttggcaacagaacaaa
tgccctgaggtagaggagttggtcttcagccattttgtgatctgtaatgacacacaggag
acactgcggtttggccaggtggatactgatgaaaatattctgctggcgagtctccacagt
caccagtacagctggcgctctcacaaatccccacagctgttacacatctgtattgaaggt
tggggcaactggcgttggtcagagcctttcagtgtggaccatgccgggacttttattaga
acaattcagtacaggggtcgaactgcttctctcatcatcaaggttcagcaactcaatgga
gtacaaaaacagattatcatctgtggaagacagatcatctgtagttacttgtctcaaagc
atagaactaaaagtcgttcagcattacattggtcaagatggacaagctgtagttcgggaa
cattttgactgcctcacagccaaacagaaattgccttcgtacatactagaaaacaatgaa
ctgacggagctgtgtgtgaaggccaaaggagatgaagactggtcaagagatgtgtgcctg
gaatccaaagcccctgagtacagcattgtcattcaggtgccatcttcaaacagttccatt
atttatgtctggtgcacagttttgactttagaacccaactctcaagtgcaacaacgaatg
attgtgttcagccctctttttatcatgaggagtcatcttccagaccccattatcatacat
ttggagaaaaggagtctgggattgagtgaaacacaaattattccaggaaaagggcaggaa
aaaccactgcaaaacatagaacctgaccttgtacatcacctgacattccaagcaagagaa
gaatatgatccttcagattgtgcagttcccatctcaacatccctcattaagcaaatagcc
actaaggtacaccctggaggcacagttaatcagatccttgacgaattctatgggccagaa
aagtcgcttcaacccatatggccctataataagaaggattctgacaggaatgaacagcta
agtcagtgggatagcccaatgcgagtgaagctgtcaatctggaagccatatgttagaact
ttgttgatagaacttctgccctgggccctgcttatcaatgaatccaaatgggacctctgg
ctatttgaaggagagaaaattgttctacaggttcctgctggcaaaattattattcctcct
aattttcaggaagcttttcaaattggaatatactgggcaaatacaaacactgtgcacaag
tcagtagcaattaaactggtccataacctgacatctccaaagtggaaagatggaggtaat
ggtgaagttgtgacactggatgaagaagcgtttgttgatactgaaataagacttggtgct
tttccaggacatcagaagttatgtcagttctgcatttcctccatggtacagcaaggtata
caaattattcagattgaagacaagactacaataatcaataatacaccatatcaaatattt
tataaaccacagctatctgtctgcaatccccattctggaaaggagtattttcgtgttcca
gacagtgctacttttagcatttgcccaggtggagagcagcctgctatgaaatccagctcc
cttccttgctgggacttgatgcctgacatcagtcagtcagtactggatgcatccctgctt
cagaaacagatcatgctgggcttttctcctgccccaggtgctgacagctcacagtgctgg
agcctgccagctatagttagaccagagtttcccagacagagtgtggcagtacccctcggg
aatttccgggaaaatggattctgtaccagggctatagtgctgacatatcaagaacacctc
ggagtgacttatttaaccctctcagaagaccctagtcctcgagtaattatccacaataga
tgtccagtaaaaatgcttataaaggaaaacattaaagatattccaaagtttgaggtttat
tgcaaaaaaattccctccgagtgctcaattcatcatgagctgtatcatcagatttccagt
tatccggactgcaagaccaaagacttacttccaagcctacttttgagagttgaacctcta
gatgaagtaacaactgagtggagtgatgccattgacatcaacagtcagggaacacaggtt
gtgttcctgactggctttggctatgtgtatgtggatgttgtacatcagtgtggcacagtc
ttcatcactgtggccccagaaggaaaagcaggacctattttaaccaataccaacagagcg
ccagagaagattgttacatttaaaatgttcatcactcagttaagcctggcagtgtttgat
gacctcacccaccacaaagcatcagctgagcttctgagactcacactggacaacattttt
ctctgtgtggccccgggagctggtcccctccctggggaagagcctgtggctgcgttgttt
gaactttactgtgtggagatctgctgtggggacctgcagctagacaaccagctttataac
aagtccaatttccactttgctgtcttagtctgccagggagaaaaagcagaacccattcag
tgttccaaaatgcagagtctcctcatatccaacaaagagttggaagaatacaaggaaaaa
tgttttatcaaactttgcatcaccttaaatgaaggcaagagcatcctctgtgatattaat
gagttcagctttgaattaaaacctgctcggttatacgtggaagacacatttgtatactac
atcaagactttgtttgacacctaccttcctaacagcaggttggctggtcactccacacac
ctctccgggggtaaacaggtgttgcccatgcaggtcacacagcacgccagggccttggtg
aatcctgtgaagttacggaaactggtgatccagccagtaaatttgctcgtcagcatccac
gcttccctcaagctgtacatagcctcagaccacactcctctctccttctcggtgtttgaa
agaggacccatcttcaccactgcgaggcagcttgtgcacgccctggcaatgcactatgcc
gctggggccctttttagagcaggctgggtagttgggtctctggatattcttggcagccct
gcaagcctggtgagaagcatcgggaacggggtcgccgacttcttcaggcttccgtatgag
gggctgacccggggccctggagccttcgtgagtggcgtctccagagggaccacatcgttt
gtaaagcacatctccaaaggtaccctcacatccatcaccaacctcgccacaagcctggcc
cggaacatggaccggctctcactggatgaggagcactacaaccggcaggaggagtggcgg
cggcagctccccgagagcctgggcgaggggcttcgacagggcctgtcccggctgggcatc
agcctgcttggtgcaattgctggtatagttgatcagccgatgcagaacttccagaaaaca
tctgaggcacaggcttcagcaggacacaaggccaagggtgtcatctcgggtgtggggaaa
ggaatcatgggggtgttcacaaagcccatcggaggagctgctgagctggtgtcacagact
ggctatggtattttacatggagctggactttctcagcttcccaaacagcgccatcagcca
agtgatctacatgctgaccaggctccaaacagccatgtcaaatatgtctggaaaatgctt
cagtctctgggcagaccagaagtccacatggccctggacgtggttctggtgaggggctca
ggccaggagcatgaagggtgcttgctgctgacatcagaagtgctcttcgtggtgagtgtc
agtgaggacacacagcagcaggccttccccgtcacagaaatcgactgtgcacaggacagc
aagcagaacaacttactcacagtgcagctcaagcagccaagagtggcctgtgatgtggag
gtagatggagtccgagagagactgtcagagcaacagtacaacagactggtggactacatc
acaaagacatcttgtcacctggcccccagctgttcttccatgcaaataccatgccctgtg
gtggctgcagaacctcccccctccactgttaaaacataccattacctggttgatccacat
tttgctcaggtcttccttagtaaatttaccatggtgaaaaataaagccctgaggaaaggg
tttccttga

DBGET integrated database retrieval system