KEGG   Homo sapiens (human): 157680Help
Entry
157680            CDS       T01001                                 

Gene name
VPS13B, CHS1, COH1
Definition
vacuolar protein sorting 13 homolog B (yeast)
Organism
hsa  Homo sapiens (human)
Disease
H00940  
Cohen syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q22.2
AA seq 863 aa AA seqDB search
MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSG
HIHELRIHVPWTKLGSEPVVITINTMECILKLKDGIQDDHESCGSNSTNRSTAESTKSSI
KPRRMQQAAPTDPDLPPGYVQSLIRRVVNNVNIVINNLILKYVEDDIVLSVNITSAECYT
VGELWDRAFMDISATDLVLRKVINFSDCTVCLDKRNASGKIEFYQDPLLYKCSFRTRLHF
TYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDL
TCHNKDMLGNITGSEDETRIDMQYPAQHKGQELYSQQDEEQPQGWVSWAWSFVPAIVSYD
DGEEDFVGNDPASTMHQQKAQTLKDPIVSIGFYCTKATVTFKLTEMQVESSYYSPQKVKS
KEVLCWEQEGTTVEALMMGEPFFDCQIGFVGCRAMCLKGIMGVKDFEENMNRSETEACFF
ICGDNLSTKGFTYLTNSLFDYRSPENNGTRAEFILDSTHHKETYTEIAGMQRFGAFYMDY
LYTMENTSGKGSTNQQDFSSGKSEDLGTVQEKSTKSLVIGPLDFRLDSSAVHRILKMIVC
ALEHEYEPYSRLKSDIKDENETILNPEEVALLEEYIPTRHTSVTLLKCTCTISMAEFNLL
DHLLPVIMGEKNSSNFMNTTNFQSLRPLPSIRILVDKINLEHSVPMYAEQLVHVVSSLTQ
PSDNLLHYCYVHCYLKIFGFQAGLTSLDCSGSYCLPVPVIPSFSTALYGKLLKLPTCWTK
RSQIAITEGIFELPNLTIQATRAQTLLLQAIYQSWSHLGNVSSSAVIEALINEIFLSIEI
GSCYVAQVDLELLASNDPPTSTS
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgctggagtcatatgtaactccaattttaatgagctatgtgaatcgctacatcaagaac
ttaaagccgtcggatctacagctttcactatggggtggagacgtggtactcagcaagctc
gagttaaagttggatgtgctggaacaggaactgaaattaccattcacttttttaagtgga
catattcatgaattgaggattcatgtaccatggacaaaactgggttcagaaccagtggta
attaccatcaatactatggaatgcattttgaaacttaaggatgggatacaggatgaccat
gaaagctgtggttctaattctaccaaccgtagtactgctgagagcacaaaatcatcaatc
aaaccgcggagaatgcagcaggctgctcctacagatcctgacttaccaccaggttatgtg
cagagtctgattagacgagttgtaaataatgtaaacattgtgataaataatctcatacta
aaatatgttgaagatgatatcgtcctttccgtcaatatcacttctgcagaatgttataca
gtaggtgaattatgggatcgtgcattcatggatatttctgcaactgatttggtgctgaga
aaggttatcaatttttctgactgtacagtttgtcttgataaacggaatgccagtggtaaa
atagaattttaccaggatcctttattatacaaatgttccttcagaactcgtcttcatttt
acatatgaaaacctaaattccaagatgccatctgttattaaaattcatactttagtggaa
agtttgaaactttctatcacagatcaacaactgcctatgtttattcgtataatgcaactt
ggaattgctctttactatggagaaataggcaattttaaagaaggcgaaatagaggacctt
acttgtcataataaagatatgctaggaaacattacaggttctgaagatgaaacaagaata
gatatgcaatatcctgctcagcataaaggtcaagagttatattcacagcaagatgaggag
cagccacagggatgggtgtcatgggcctggtcctttgtgcctgcaattgtgagttatgac
gatggcgaggaagactttgttgggaacgatcctgcatcaaccatgcatcaacaaaaagca
cagactttgaaggatcctattgtttctataggattttattgcacaaaggcaacggtgact
ttcaaactcacagaaatgcaagttgagagtagttattacagtccacagaaagtaaaatct
aaagaagtattgtgttgggaacaagaaggaactacagttgaggcccttatgatgggagaa
cctttctttgattgccagattgggtttgttggttgcagagccatgtgccttaaaggaatt
atgggtgttaaagattttgaagagaatatgaatagaagtgaaactgaagcctgtttcttc
atttgtggtgacaatttgagtacgaaaggtttcacataccttacaaattcattgtttgat
taccgaagcccagaaaataatggtactcgcgcagaatttatcttggattcaactcatcat
aaggagacatacactgagatagctggaatgcaacggtttggggctttttatatggattac
ctgtatacaatggagaacactagtggcaaaggttccacaaatcaacaagacttttcttca
gggaaaagtgaagatttgggaacagttcaggagaagtccaccaaaagccttgttataggt
cctcttgattttcgtttggatagcagtgcggtgcataggattttgaaaatgattgtgtgt
gccttggaacatgaatatgaaccatatagcaggctaaaatcagatattaaggatgaaaat
gaaacaatactgaatcctgaagaggtggctcttctggaggaatatattcctactcgacat
acaagtgttactctcctcaaatgtacctgcacaatttccatggctgaattcaacttgctg
gaccatttactacctgtcattatgggagaaaagaactcaagtaacttcatgaatactaca
aacttccagtctcttcggcctttgccatccattcgaatattggtggataaaattaatctg
gaacattcagtgccaatgtatgctgaacagttggtgcatgtggtcagcagccttactcaa
ccttctgataacctgcttcattattgttatgtacactgctatcttaagatatttggtttc
caggcaggactgacgtctttggattgcagtggatcttactgcttacctgtaccagttatt
ccctctttcagcactgctctttatgggaaacttctgaaactccccacatgctggaccaaa
agatctcagattgctataactgaaggtatatttgaacttccaaatctcacaattcaagct
acaagagcacagacacttctcttgcaagcaatatatcaaagttggtctcatcttggaaat
gtcagctcttccgcagtgattgaagctttgataaatgaaatcttcctaagtatagagatt
gggtcttgctatgttgcccaggttgatcttgaactcctggcctcaaatgatcctcccacc
tcaacctcctga

DBGET integrated database retrieval system