KEGG   Homo sapiens (human): 1589Help
Entry
1589              CDS       T01001                                 

Gene name
CYP21A2, CA21H, CAH1, CPS1, CYP21, CYP21B, P450c21B
Definition
cytochrome P450, family 21, subfamily A, polypeptide 2 (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Disease
H00216  
Congenital adrenal hyperplasia (CAH)
H00599  
46,XX disorders of sex development (Disorders related to androgen excess)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    1589 (CYP21A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     1589 (CYP21A2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP21 family
   1589 (CYP21A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 495 aa AA seqDB search
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLWKAH
KKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGD
KIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEM
QLRQHKESLVAGQWRDMMDYMLQGVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWERPHEFWPDRFLEPGKNSRAL
AFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVR
LQPRGMGAHSPGQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgggcctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aactggtggaagctccggagcctccacctcccgcctcttgccccgggcttcttgcacctg
ctgcagcccgacctccccatctatctgcttggcctgactcagaaattcgggcccatctac
aggctccaccttgggctgcaagatgtggtggtgctgaactccaagaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaggaactacccggacctgtccttgggagactactccctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatccgtgactccatggagccagtggtg
gagcagctgacccaggagttctgtgagcgcatgagagcccagcccggcacccctgtggcc
attgaggaggaattctctctcctcacctgcagcatcatctgttacctcaccttcggagac
aagatcaaggacgacaacttaatgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggacgtgattccctttctcaggttcttcccc
aatccaggtctccggaggctgaagcaggccatagagaagagggatcacatcgtggagatg
cagctgaggcagcacaaggagagcctcgtggcaggccagtggagggacatgatggactac
atgctccaaggggtggcgcagccgagcatggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctgatcggtggcactgagaccacagcaaacacc
ctctcctgggccgtggtttttttgcttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactgggccctggtgcctccagctcccgggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgccgaggtgctgcgcctgcggcccgttgtg
cccttagccttgccccaccgcaccacacggcccagcagcatctccggctacgacatccct
gagggcacagtcatcattccgaacctccaaggcgcccacctggatgagacggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagaactccagagctctg
gccttcggctgcggtgcccgcgtgtgcctgggcgagccgctggcgcgcctggagctcttc
gtggtgctgacccgactgctgcaggccttcacgctgctgccctccggggacgccctgccc
tccctgcagcccctgccccactgcagtgtcatcctcaagatgcagcctttccaagtgcgg
ctgcagccccgggggatgggggcccacagcccgggccagagccagtga

DBGET integrated database retrieval system