KEGG   Homo sapiens (human): 1621Help
Entry
1621              CDS       T01001                                 

Gene name
DBH, DBM
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H01005  
Dopamine beta-hydroxylase deficiency
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    1621 (DBH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     1621 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 617 aa AA seqDB search
MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GRSPAGPTVVSIGGGKG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcagtcgctgggccagcctgcccggccccagcatgcgggaggcagccttc
atgtacagcacagcagtggccatcttcctggtcatcctggtggccgcactgcagggctcg
gctccccgtgagagccccctcccctatcacatccccctggacccggaggggtccctggag
ctctcatggaatgtcagctacacccaggaggccatccatttccagctcctggtgcggagg
ctcaaggctggcgtcctgtttgggatgtccgaccgtggcgagcttgagaacgcagatctc
gtggtgctctggaccgatggggacactgcctattttgcggacgcctggagtgaccagaag
gggcagatccacctggatccccagcaggactaccagctgctgcaggtgcagaggacccca
gaaggcctgaccctgcttttcaagaggccctttggcacctgcgaccccaaggattacctc
attgaagacggcactgtccacttggtctacgggatcctggaggagccgttccggtcactg
gaggccatcaacggctcgggcctgcagatggggctgcagagggtgcagctcctgaagccc
aatatccccgaaccggagttgccctcagacgcgtgcaccatggaggtccaagctcccaat
atccagatccccagccaggagaccacgtactggtgctacattaaggagcttccaaagggc
ttctctcggcaccacattatcaagtacgagcccatcgtcaccaagggcaatgaggccctt
gtccaccacatggaagtcttccagtgcgcccccgagatggacagcgtcccccacttcagc
gggccctgcgactccaagatgaaacccgaccgcctcaactactgccgccacgtgctggcc
gcctgggccctgggtgccaaggcattttactacccagaggaagccggccttgccttcggg
ggtccagggtcctccagatatctccgcctggaagttcactaccacaacccactggtgata
gaaggacgaaacgactcctcaggcatccgcttgtactacacagccaagctgcggcgcttc
aacgcggggatcatggagctgggactggtgtacacgccagtgatggccattccaccacgg
gagaccgccttcatcctcactggctactgcacggacaagtgcacccagctggcactgcct
ccctccgggatccacatcttcgcctctcagctccacacacacctgactgggagaaaggtg
gtcacagtgctggtccgggacggccgggagtgggagatcgtgaaccaggacaatcactac
agccctcacttccaggagatccgcatgttgaagaaggtcgtgtcggtccatccgggagat
gtgctcatcacctcctgcacgtacaacacagaagaccgggagctggccacagtggggggc
ttcgggatcctggaggagatgtgtgtcaactacgtgcactactacccccagacgcagctg
gagctctgcaagagcgctgtggacgccggcttcctgcagaagtacttccacctcatcaac
aggttcaacaacgaggatgtctgcacctgccctcaggcgtccgtgtctcagcagttcacc
tctgttccctggaactccttcaaccgcgacgtactgaaggccctgtacagcttcgcgccc
atctccatgcactgcaacaagtcctcagccgtccgcttccagggtgaatggaacctgcag
cccctgcccaaggtcatctccacactggaagagcccaccccacagtgccccaccagccag
ggccgaagccctgctggccccaccgttgtcagcattggtgggggcaaaggctga

DBGET integrated database retrieval system