KEGG   Homo sapiens (human): 1621Help
Entry
1621              CDS       T01001                                 

Gene name
DBH, DBM
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H01005  
Dopamine beta-hydroxylase deficiency
Drug target
Other: 
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hsa00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 617 aa AA seqDB search
MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GRSPAGPTVVSIGGGKG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcagtcgctgggccagcctgcccggccccagcatgcgggaggcagccttc
atgtacagcacagcagtggccatcttcctggtcatcctggtggccgcactgcagggctcg
gctccccgtgagagccccctcccctatcacatccccctggacccggaggggtccctggag
ctctcatggaatgtcagctacacccaggaggccatccatttccagctcctggtgcggagg
ctcaaggctggcgtcctgtttgggatgtccgaccgtggcgagcttgagaacgcagatctc
gtggtgctctggaccgatggggacactgcctattttgcggacgcctggagtgaccagaag
gggcagatccacctggatccccagcaggactaccagctgctgcaggtgcagaggacccca
gaaggcctgaccctgcttttcaagaggccctttggcacctgcgaccccaaggattacctc
attgaagacggcactgtccacttggtctacgggatcctggaggagccgttccggtcactg
gaggccatcaacggctcgggcctgcagatggggctgcagagggtgcagctcctgaagccc
aatatccccgaaccggagttgccctcagacgcgtgcaccatggaggtccaagctcccaat
atccagatccccagccaggagaccacgtactggtgctacattaaggagcttccaaagggc
ttctctcggcaccacattatcaagtacgagcccatcgtcaccaagggcaatgaggccctt
gtccaccacatggaagtcttccagtgcgcccccgagatggacagcgtcccccacttcagc
gggccctgcgactccaagatgaaacccgaccgcctcaactactgccgccacgtgctggcc
gcctgggccctgggtgccaaggcattttactacccagaggaagccggccttgccttcggg
ggtccagggtcctccagatatctccgcctggaagttcactaccacaacccactggtgata
gaaggacgaaacgactcctcaggcatccgcttgtactacacagccaagctgcggcgcttc
aacgcggggatcatggagctgggactggtgtacacgccagtgatggccattccaccacgg
gagaccgccttcatcctcactggctactgcacggacaagtgcacccagctggcactgcct
ccctccgggatccacatcttcgcctctcagctccacacacacctgactgggagaaaggtg
gtcacagtgctggtccgggacggccgggagtgggagatcgtgaaccaggacaatcactac
agccctcacttccaggagatccgcatgttgaagaaggtcgtgtcggtccatccgggagat
gtgctcatcacctcctgcacgtacaacacagaagaccgggagctggccacagtggggggc
ttcgggatcctggaggagatgtgtgtcaactacgtgcactactacccccagacgcagctg
gagctctgcaagagcgctgtggacgccggcttcctgcagaagtacttccacctcatcaac
aggttcaacaacgaggatgtctgcacctgccctcaggcgtccgtgtctcagcagttcacc
tctgttccctggaactccttcaaccgcgacgtactgaaggccctgtacagcttcgcgccc
atctccatgcactgcaacaagtcctcagccgtccgcttccagggtgaatggaacctgcag
cccctgcccaaggtcatctccacactggaagagcccaccccacagtgccccaccagccag
ggccgaagccctgctggccccaccgttgtcagcattggtgggggcaaaggctga

DBGET integrated database retrieval system