KEGG   Homo sapiens (human): 1636Help
Entry
1636              CDS       T01001                                 

Gene name
ACE, ACE1, CD143, DCP, DCP1, ICH, MVCD3
Definition
angiotensin I converting enzyme (EC:3.4.15.1)
Orthology
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Disease
H00083  
Allograft rejection
H00575  
Renal tubular dysgenesis
Drug target
Captopril: 
Enalapril: 
Lisinopril: 
Perindopril: 
Ramipril: 
Quinapril: 
Benazepril: 
Cilazapril: 
Fosinopril: 
Trandolapril: 
Spirapril: 
Delapril: 
Moexipril: 
Temocapril: 
Zofenopril: 
Imidapril: 
Other: 
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:hsa04614]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 1306 aa AA seqDB search
MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV
LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI
IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR
SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL
EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF
PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI
GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL
KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS
QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI
IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY
EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER
LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD
VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS
ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE
ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW
LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccgggggccggggctgctgctgccgctgccgctgctgttg
ctgctgccgccgcagcccgccctggcgttggaccccgggctgcagcccggcaacttttct
gctgacgaggccggggcgcagctcttcgcgcagagctacaactccagcgccgaacaggtg
ctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgcggagaatgca
aggcgccaggaggaagcagccctgctcagccaggagtttgcggaggcctggggccagaag
gccaaggagctgtatgaaccgatctggcagaacttcacggacccgcagctgcgcaggatc
atcggagctgtgcgcaccctgggctctgccaacctgcccctggctaagcggcagcagtac
aacgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctccccaac
aagactgccacctgctggtccctggacccagatctcaccaacatcctggcttcctcgcga
agctacgccatgctcctgtttgcctgggagggctggcacaacgctgcgggcatcccgctg
aaaccgctgtacgaggatttcactgccctcagcaatgaagcctacaagcaggacggcttc
acagacacgggggcctactggcgctcctggtacaactcccccaccttcgaggacgatctg
gaacacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgccgc
gcactgcatcgccgatacggagacagatacatcaacctcaggggacccatccctgctcat
ctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcctttc
ccagacaagcccaacctcgatgtcaccagtactatgctgcagcagggctggaacgccacg
cacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcctccc
gagttctgggaagggtcgatgctggagaagccggccgacgggcgggaagtggtgtgccac
gcctcggcttgggacttctacaacaggaaagacttcaggatcaagcagtgcacacgggtc
acgatggaccagctctccacagtgcaccatgagatgggccatatacagtactacctgcag
tacaaggatctgcccgtctccctgcgtcggggggccaaccccggcttccatgaggccatt
ggggacgtgctggcgctctcggtctccactcctgaacatctgcacaaaatcggcctgctg
gaccgtgtcaccaatgacacggaaagtgacatcaattacttgctaaaaatggcactggaa
aaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtctttagt
gggcgtacccccccttcccgctacaacttcgactggtggtatcttcgaaccaagtatcag
gggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagtttcat
gttccaaatgtgacaccatacatcaggtactttgtgagttttgtcctgcagttccagttc
catgaagccctgtgcaaggaggcaggctatgagggcccactgcaccagtgtgacatctac
cggtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccaggccc
tggcaggaggtgctgaaggacatggtcggcttagatgccctggatgcccagccgctgctc
aagtacttccagccagtcacccagtggctgcaggagcagaaccagcagaacggcgaggtc
ctgggctggcccgagtaccagtggcacccgccgttgcctgacaactacccggagggcata
gacctggtgactgatgaggctgaggccagcaagtttgtggaggaatatgaccggacatcc
caggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacatcaccaca
gagaccagcaagattctgctgcagaagaacatgcaaatagccaaccacaccctgaagtac
ggcacccaggccaggaagtttgatgtgaaccagttgcagaacaccactatcaagcggatc
ataaagaaggttcaggacctagaacgggcagcactgcctgcccaggagctggaggagtac
aacaagatcctgttggatatggaaaccacctacagcgtggccactgtgtgccacccgaat
ggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacgtcccggaaatat
gaagacctgttatgggcatgggagggctggcgagacaaggcggggagagccatcctccag
ttttacccgaaatacgtggaactcatcaaccaggctgcccggctcaatggctatgtagat
gcaggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggagcgg
ctcttccaggagctgcagccactctacctcaacctgcatgcctacgtgcgccgggccctg
caccgtcactacggggcccagcacatcaacctggaggggcccattcctgctcacctgctg
gggaacatgtgggcgcagacctggtccaacatctatgacttggtggtgcccttcccttca
gccccctcgatggacaccacagaggctatgctaaagcagggctggacgcccaggaggatg
tttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgagttc
tggaacaagtcgatgctggagaagccaaccgacgggcgggaggtggtctgccacgcctcg
gcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaacttg
gaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtacaaa
gacttacctgtggccttgagggagggtgccaaccccggcttccatgaggccattggggac
gtgctagccctctcagtgtctacgcccaagcacctgcacagtctcaacctgctgagcagt
gagggtggcagcgacgagcatgacatcaactttctgatgaagatggcccttgacaagatc
gcctttatccccttcagctacctcgtcgatcagtggcgctggagggtatttgatggaagc
atcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggcctc
tgccccccagtgcccaggactcaaggtgactttgacccaggggccaagttccacattcct
tctagcgtgccttacatcaggtactttgtcagcttcatcatccagttccagttccacgag
gcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccagtcc
aaggaggccgggcagcgcctggcgaccgccatgaagctgggcttcagtaggccgtggccg
gaagccatgcagctgatcacgggccagcccaacatgagcgcctcggccatgttgagctac
ttcaagccgctgctggactggctccgcacggagaacgagctgcatggggagaagctgggc
tggccgcagtacaactggacgccgaactccgctcgctcagaagggcccctcccagacagc
ggccgcgtcagcttcctgggcctggacctggatgcgcagcaggcccgcgtgggccagtgg
ctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcggctc
ttcagcatccgccaccgcagcctccaccggcactcccacgggccccagttcggctccgag
gtggagctgagacactcctga

DBGET integrated database retrieval system