KEGG   Homo sapiens (human): 1641Help
Entry
1641              CDS       T01001                                 

Gene name
DCX, DBCN, DC, LISX, SCLH, XLIS
Definition
doublecortin
Orthology
K16579  
neuronal migration protein doublecortin
Organism
hsa  Homo sapiens (human)
Disease
H00268  
Lissencephaly (LIS)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq22.3-q23
AA seq 441 aa AA seqDB search
MKTLPLHSHCTEMQRLLPKLEMLTLGSSFCSLQGEFCQAMDSFTTVSHVGMCEETDASFN
VFSPKFQFDRSHCQSLRFHQNMELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYR
TRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQ
GVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAP
QSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIK
LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPS
ATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLR
KHKDLYLPLSLDDSDSLGDSM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactcccccttcatagtcattgtactgaaatgcaaagactgcttcctaagctg
gagatgctaaccttgggtagctccttctgttctcttcaaggggaattttgtcaggctatg
gattcatttacaactgttagtcatgtgggcatgtgtgaggaaacagatgccagttttaat
gtatttagcccgaagttccaatttgataggagccactgtcagtctctgaggttccaccaa
aatatggaacttgattttggacactttgacgaaagagataagacatccaggaacatgcga
ggctcccggatgaatgggttgcctagccccactcacagcgcccactgtagcttctaccga
accagaaccttgcaggcactgagtaatgagaagaaagccaagaaggtacgtttctaccgc
aatggggaccgctacttcaaggggattgtgtacgctgtgtcctctgaccgttttcgcagc
tttgacgccttgctggctgacctgacgcgatctctgtctgacaacatcaacctgcctcag
ggagtgcgttacatttacaccattgatggatccaggaagatcggaagcatggatgaactg
gaggaaggggaaagctatgtctgttcctcagacaacttctttaaaaaggtggagtacacc
aagaatgtcaatcccaactggtctgtcaacgtaaaaacatctgccaatatgaaagccccc
cagtccttggctagcagcaacagtgcacaggccagggagaacaaggactttgtgcgcccc
aagctggttaccatcatccgcagtggggtgaagcctcggaaggctgtgcgtgtgcttctg
aacaagaagacagcccactcttttgagcaagtcctcactgatatcacagaagccatcaaa
ctggagaccggggttgtcaaaaaactctacactctggatggaaaacaggtaacttgtctc
catgatttctttggtgatgatgatgtgtttattgcctgtggtcctgaaaaatttcgctat
gctcaggatgatttttctctggatgaaaatgaatgccgagtcatgaagggaaacccatca
gccacagctggcccaaaggcatccccaacacctcagaagacttcagccaagagccctggt
cctatgcgccgaagcaagtctccagctgactcagcaaacggaacctccagcagccagctc
tctacccccaagtctaagcagtctcccatctctacgcccaccagtcctggcagcctccgg
aagcacaaggacctgtacctgcctctgtccttggatgactcggactcgcttggtgattcc
atgtaa

DBGET integrated database retrieval system